KEGG   Homo sapiens (human): 701Help
Entry
701               CDS       T01001                                 

Gene name
BUB1B, BUB1beta, BUBR1, Bub1A, MAD3L, MVA1, SSK1, hBUBR1
Definition
BUB1 mitotic checkpoint serine/threonine kinase B (EC:2.7.11.1)
Orthology
K06637  
mitotic checkpoint serine/threonine-protein kinase BUB1 beta [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
HTLV-I infection
Disease
H01288  
Mosaic variegated aneuploidy (MVA) syndrome
Class
Cellular Processes; Cell growth and death; Cell cycle [PATH:hsa04110]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q15
AA seq 1050 aa AA seqDB search
MAAVKKEGGALSEAMSLEGDEWELSKENVQPLRQGRIMSTLQGALAQESACNNTLQQQKR
AFEYEIRFYTGNDPLDVWDRYISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPR
FLNLWLKLGRLCNEPLDMYSYLHNQGIGVSLAQFYISWAEEYEARENFRKADAIFQEGIQ
QKAEPLERLQSQHRQFQARVSRQTLLALEKEEEEEVFESSVPQRSTLAELKSKGKKTARA
PIIRVGGALKAPSQNRGLQNPFPQQMQNNSRITVFDENADEASTAELSKPTVQPWIAPPM
PRAKENELQAGPWNTGRSLEHRPRGNTASLIAVPAVLPSFTPYVEETAQQPVMTPCKIEP
SINHILSTRKPGKEEGDPLQRVQSHQQASEEKKEKMMYCKEKIYAGVGEFSFEEIRAEVF
RKKLKEQREAELLTSAEKRAEMQKQIEEMEKKLKEIQTTQQERTGDQQEETMPTKETTKL
QIASESQKIPGMTLSSSVCQVNCCARETSLAENIWQEQPHSKGPSVPFSIFDEFLLSEKK
NKSPPADPPRVLAQRRPLAVLKTSESITSNEDVSPDVCDEFTGIEPLSEDAIITGFRNVT
ICPNPEDTCDFARAARFVSTPFHEIMSLKDLPSDPERLLPEEDLDVKTSEDQQTACGTIY
SQTLSIKKLSPIIEDSREATHSSGFSGSSASVASTSSIKCLQIPEKLELTNETSENPTQS
PWCSQYRRQLLKSLPELSASAELCIEDRPMPKLEIEKEIELGNEDYCIKREYLICEDYKL
FWVAPRNSAELTVIKVSSQPVPWDFYINLKLKERLNEDFDHFCSCYQYQDGCIVWHQYIN
CFTLQDLLQHSEYITHEITVLIIYNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPYDC
NKNNQALKIVDFSYSVDLRVQLDVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLA
HLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFVRILNANDEATVSVLGELAAEMN
GVFDTTFQSHLNKALWKVGKLTSPGALLFQ
NT seq 3153 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtgaagaaggaagggggtgctctgagtgaagccatgtccctggagggagat
gaatgggaactgagtaaagaaaatgtacaacctttaaggcaagggcggatcatgtccacg
cttcagggagcactggcacaagaatctgcctgtaacaatactcttcagcagcagaaacgg
gcatttgaatatgaaattcgattttacactggaaatgaccctctggatgtttgggatagg
tatatcagctggacagagcagaactatcctcaaggtgggaaggagagtaatatgtcaacg
ttattagaaagagctgtagaagcactacaaggagaaaaacgatattatagtgatcctcga
tttctcaatctctggcttaaattagggcgtttatgcaatgagcctttggatatgtacagt
tacttgcacaaccaagggattggtgtttcacttgctcagttctatatctcatgggcagaa
gaatatgaagctagagaaaactttaggaaagcagatgcgatatttcaggaagggattcaa
cagaaggctgaaccactagaaagactacagtcccagcaccgacaattccaagctcgagtg
tctcggcaaactctgttggcacttgagaaagaagaagaggaggaagtttttgagtcttct
gtaccacaacgaagcacactagctgaactaaagagcaaagggaaaaagacagcaagagct
ccaatcatccgtgtaggaggtgctctcaaggctccaagccagaacagaggactccaaaat
ccatttcctcaacagatgcaaaataatagtagaattactgtttttgatgaaaatgctgat
gaggcttctacagcagagttgtctaagcctacagtccagccatggatagcaccccccatg
cccagggccaaagagaatgagctgcaagcaggcccttggaacacaggcaggtccttggaa
cacaggcctcgtggcaatacagcttcactgatagctgtacccgctgtgcttcccagtttc
actccatatgtggaagagactgcacaacagccagttatgacaccatgtaaaattgaacct
agtataaaccacatcctaagcaccagaaagcctggaaaggaagaaggagatcctctacaa
agggttcagagccatcagcaagcgtctgaggagaagaaagagaagatgatgtattgtaag
gagaagatttatgcaggagtaggggaattctcctttgaagaaattcgggctgaagttttc
cggaagaaattaaaagagcaaagggaagccgagctattgaccagtgcagagaagagagca
gaaatgcagaaacagattgaagagatggagaagaagctaaaagaaatccaaactactcag
caagaaagaacaggtgatcagcaagaagagacgatgcctacaaaggagacaactaaactg
caaattgcttccgagtctcagaaaataccaggaatgactctatccagttctgtttgtcaa
gtaaactgttgtgccagagaaacttcacttgcggagaacatttggcaggaacaacctcat
tctaaaggtcccagtgtacctttctccatttttgatgagtttcttctttcagaaaagaag
aataaaagtcctcctgcagatcccccacgagttttagctcaacgaagaccccttgcagtt
ctcaaaacctcagaaagcatcacctcaaatgaagatgtgtctccagatgtttgtgatgaa
tttacaggaattgaacccttgagcgaggatgccattatcacaggcttcagaaatgtaaca
atttgtcctaacccagaagacacttgtgactttgccagagcagctcgttttgtatccact
ccttttcatgagataatgtccttgaaggatctcccttctgatcctgagagactgttaccg
gaagaagatctagatgtaaagacctctgaggaccagcagacagcttgtggcactatctac
agtcagactctcagcatcaagaagctgagcccaattattgaagacagtcgtgaagccaca
cactcctctggcttctctggttcttctgcctcggttgcaagcacctcctccatcaaatgt
cttcaaattcctgagaaactagaacttactaatgagacttcagaaaaccctactcagtca
ccatggtgttcacagtatcgcagacagctactgaagtccctaccagagttaagtgcctct
gcagagttgtgtatagaagacagaccaatgcctaagttggaaattgagaaggaaattgaa
ttaggtaatgaggattactgcattaaacgagaatacctaatatgtgaagattacaagtta
ttctgggtggcgccaagaaactctgcagaattaacagtaataaaggtatcttctcaacct
gtcccatgggacttttatatcaacctcaagttaaaggaacgtttaaatgaagattttgat
catttttgcagctgttatcaatatcaagatggctgtattgtttggcaccaatatataaac
tgcttcacccttcaggatcttctccaacacagtgaatatattacccatgaaataacagtg
ttgattatttataaccttttgacaatagtggagatgctacacaaagcagaaatagtccat
ggtgacttgagtccaaggtgtctgattctcagaaacagaatccacgatccctatgattgt
aacaagaacaatcaagctttgaagatagtggacttttcctacagtgttgaccttagggtg
cagctggatgtttttaccctcagcggctttcggactgtacagatcctggaaggacaaaag
atcctggctaactgttcttctccctaccaggtagacctgtttggtatagcagatttagca
catttactattgttcaaggaacacctacaggtcttctgggatgggtccttctggaaactt
agccaaaatatttctgagctaaaagatggtgaattgtggaataaattctttgtgcggatt
ctgaatgccaatgatgaggccacagtgtctgttcttggggagcttgcagcagaaatgaat
ggggtttttgacactacattccaaagtcacctgaacaaagccttatggaaggtagggaag
ttaactagtcctggggctttgctctttcagtga

DBGET integrated database retrieval system