KEGG   Homo sapiens (human): 7010Help
Entry
7010              CDS       T01001                                 

Gene name
TEK, CD202B, TIE-2, TIE2, VMCM, VMCM1
Definition
TEK tyrosine kinase, endothelial (EC:2.7.10.1)
Orthology
K05121  
endothelial-specific receptor tyrosine kinase [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
HIF-1 signaling pathway
PI3K-Akt signaling pathway
Rheumatoid arthritis
Disease
H00531  
Venous malformations
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    7010 (TEK)
   04015 Rap1 signaling pathway
    7010 (TEK)
   04066 HIF-1 signaling pathway
    7010 (TEK)
   04151 PI3K-Akt signaling pathway
    7010 (TEK)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    7010 (TEK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     7010 (TEK)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  Tie family
   7010 (TEK)
Enzyme-linked receptors [BR:hsa01020]
 Receptor tyrosine kinases
  RTK class XI (TIE receptor family)
   7010 (TEK)
Cytokine receptors [BR:hsa04050]
 Receptor tyrosine kinase
  RTK class XI (TIE receptor family)
   7010 (TEK)
Cellular antigens [BR:hsa04090]
 Proteins
  7010 (TEK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9p21
AA seq 1124 aa AA seqDB search
MDSLASLVLCGVSLLLSGTVEGAMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRD
FEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQ
QASFLPATLTMTVDKGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPH
AQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPECNHLCTACMNNGVCHEDTGEC
ICPPGFMGRTCEKACELHTFGRTCKERCSGQEGCKSYVFCLPDPYGCSCATGWKGLQCNE
ACHPGFYGPDCKLRCSCNNGEMCDRFQGCLCSPGWQGLQCEREGIPRMTPKIVDLPDHIE
VNSGKFNPICKASGWPLPTNEEMTLVKPDGTVLHPKDFNHTDHFSVAIFTIHRILPPDSG
VWVCSVNTVAGMVEKPFNISVKVLPKPLNAPNVIDTGHNFAVINISSEPYFGDGPIKSKK
LLYKPVNHYEAWQHIQVTNEIVTLNYLEPRTEYELCVQLVRRGEGGEGHPGPVRRFTTAS
IGLPPPRGLNLLPKSQTTLNLTWQPIFPSSEDDFYVEVERRSVQKSDQQNIKVPGNLTSV
LLNNLHPREQYVVRARVNTKAQGEWSEDLTAWTLSDILPPQPENIKISNITHSSAVISWT
ILDGYSISSITIRYKVQGKNEDQHVDVKIKNATITQYQLKGLEPETAYQVDIFAENNIGS
SNPAFSHELVTLPESQAPADLGGGKMLLIAILGSAGMTCLTVLLAFLIILQLKRANVQRR
MAQAFQNVREEPAVQFNSGTLALNRKVKNNPDPTIYPVLDWNDIKFQDVIGEGNFGQVLK
ARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYL
AIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQF
IHRDLAARNILVGENYVAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSD
VWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPY
ERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAEEAA
NT seq 3375 nt NT seq  +upstreamnt  +downstreamnt
atggactctttagccagcttagttctctgtggagtcagcttgctcctttctggaactgtg
gaaggtgccatggacttgatcttgatcaattccctacctcttgtatctgatgctgaaaca
tctctcacctgcattgcctctgggtggcgcccccatgagcccatcaccataggaagggac
tttgaagccttaatgaaccagcaccaggatccgctggaagttactcaagatgtgaccaga
gaatgggctaaaaaagttgtttggaagagagaaaaggctagtaagatcaatggtgcttat
ttctgtgaagggcgagttcgaggagaggcaatcaggatacgaaccatgaagatgcgtcaa
caagcttccttcctaccagctactttaactatgactgtggacaagggagataacgtgaac
atatctttcaaaaaggtattgattaaagaagaagatgcagtgatttacaaaaatggttcc
ttcatccattcagtgccccggcatgaagtacctgatattctagaagtacacctgcctcat
gctcagccccaggatgctggagtgtactcggccaggtatataggaggaaacctcttcacc
tcggccttcaccaggctgatagtccggagatgtgaagcccagaagtggggacctgaatgc
aaccatctctgtactgcttgtatgaacaatggtgtctgccatgaagatactggagaatgc
atttgccctcctgggtttatgggaaggacgtgtgagaaggcttgtgaactgcacacgttt
ggcagaacttgtaaagaaaggtgcagtggacaagagggatgcaagtcttatgtgttctgt
ctccctgacccctatgggtgttcctgtgccacaggctggaagggtctgcagtgcaatgaa
gcatgccaccctggtttttacgggccagattgtaagcttaggtgcagctgcaacaatggg
gagatgtgtgatcgcttccaaggatgtctctgctctccaggatggcaggggctccagtgt
gagagagaaggcataccgaggatgaccccaaagatagtggatttgccagatcatatagaa
gtaaacagtggtaaatttaatcccatttgcaaagcttctggctggccgctacctactaat
gaagaaatgaccctggtgaagccggatgggacagtgctccatccaaaagactttaaccat
acggatcatttctcagtagccatattcaccatccaccggatcctcccccctgactcagga
gtttgggtctgcagtgtgaacacagtggctgggatggtggaaaagcccttcaacatttct
gttaaagttcttccaaagcccctgaatgccccaaacgtgattgacactggacataacttt
gctgtcatcaacatcagctctgagccttactttggggatggaccaatcaaatccaagaag
cttctatacaaacccgttaatcactatgaggcttggcaacatattcaagtgacaaatgag
attgttacactcaactatttggaacctcggacagaatatgaactctgtgtgcaactggtc
cgtcgtggagagggtggggaagggcatcctggacctgtgagacgcttcacaacagcttct
atcggactccctcctccaagaggtctaaatctcctgcctaaaagtcagaccactctaaat
ttgacctggcaaccaatatttccaagctcggaagatgacttttatgttgaagtggagaga
aggtctgtgcaaaaaagtgatcagcagaatattaaagttccaggcaacttgacttcggtg
ctacttaacaacttacatcccagggagcagtacgtggtccgagctagagtcaacaccaag
gcccagggggaatggagtgaagatctcactgcttggacccttagtgacattcttcctcct
caaccagaaaacatcaagatttccaacattacacactcctcagctgtgatttcttggaca
atattggatggctattctatttcttctattactatccgttacaaggttcaaggcaagaat
gaagaccagcacgttgatgtgaagataaagaatgccaccatcactcagtatcagctcaag
ggcctagagcctgaaacagcataccaggtggacatttttgcagagaacaacatagggtca
agcaacccagccttttctcatgaactggtgaccctcccagaatctcaagcaccagcggac
ctcggaggggggaagatgctgcttatagccatccttggctctgctggaatgacctgcctg
actgtgctgttggcctttctgatcatattgcaattgaagagggcaaatgtgcaaaggaga
atggcccaagccttccaaaacgtgagggaagaaccagctgtgcagttcaactcagggact
ctggccctaaacaggaaggtcaaaaacaacccagatcctacaatttatccagtgcttgac
tggaatgacatcaaatttcaagatgtgattggggagggcaattttggccaagttcttaag
gcgcgcatcaagaaggatgggttacggatggatgctgccatcaaaagaatgaaagaatat
gcctccaaagatgatcacagggactttgcaggagaactggaagttctttgtaaacttgga
caccatccaaacatcatcaatctcttaggagcatgtgaacatcgaggctacttgtacctg
gccattgagtacgcgccccatggaaaccttctggacttccttcgcaagagccgtgtgctg
gagacggacccagcatttgccattgccaatagcaccgcgtccacactgtcctcccagcag
ctccttcacttcgctgccgacgtggcccggggcatggactacttgagccaaaaacagttt
atccacagggatctggctgccagaaacattttagttggtgaaaactatgtggcaaaaata
gcagattttggattgtcccgaggtcaagaggtgtatgtgaaaaagacaatgggaaggctc
ccagtgcgctggatggccatcgagtcactgaattacagtgtgtacacaaccaacagtgat
gtatggtcctatggtgtgttactatgggagattgttagcttaggaggcacaccctactgc
gggatgacttgtgcagaactctacgagaagctgccccagggctacagactggagaagccc
ctgaactgtgatgatgaggtgtatgatctaatgagacaatgctggcgggagaagccttat
gagaggccatcatttgcccagatattggtgtccttaaacagaatgttagaggagcgaaag
acctacgtgaataccacgctttatgagaagtttacttatgcaggaattgactgttctgct
gaagaagcggcctag

DBGET integrated database retrieval system