KEGG   Homo sapiens (human): 7010Help
Entry
7010              CDS       T01001                                 

Gene name
TEK, CD202B, GLC3E, TIE-2, TIE2, VMCM, VMCM1
Definition
(RefSeq) TEK receptor tyrosine kinase
  KO
K05121  endothelial-specific receptor tyrosine kinase [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa05323  Rheumatoid arthritis
Disease
H00531  Venous malformations
H02044  Cutaneous and mucosal venous malformation
Drug target
Altiratinib: D10862
Rebastinib (DG01368): D10334 D10399
Regorafenib (DG00720): D10137 D10138
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    7010 (TEK)
   04015 Rap1 signaling pathway
    7010 (TEK)
   04010 MAPK signaling pathway
    7010 (TEK)
   04066 HIF-1 signaling pathway
    7010 (TEK)
   04151 PI3K-Akt signaling pathway
    7010 (TEK)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    7010 (TEK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     7010 (TEK)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  TIE family
   7010 (TEK)
CD molecules [BR:hsa04090]
 Proteins
  7010 (TEK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Ig_Tie2_1 fn3 Pur_ac_phosph_N EGF_2 fn3_2 APH hEGF DUF2369 Haspin_kinase DUF4702
Motif
Other DBs
NCBI-GeneID: 7010
NCBI-ProteinID: NP_000450
OMIM: 600221
HGNC: 11724
Ensembl: ENSG00000120156
Vega: OTTHUMG00000019712
Pharos: Q02763(Tclin)
UniProt: Q02763 Q59HG2
Structure
PDB: 

Jmol
Position
9p21.2
AA seq 1124 aa AA seqDB search
MDSLASLVLCGVSLLLSGTVEGAMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRD
FEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQ
QASFLPATLTMTVDKGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPH
AQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPECNHLCTACMNNGVCHEDTGEC
ICPPGFMGRTCEKACELHTFGRTCKERCSGQEGCKSYVFCLPDPYGCSCATGWKGLQCNE
ACHPGFYGPDCKLRCSCNNGEMCDRFQGCLCSPGWQGLQCEREGIPRMTPKIVDLPDHIE
VNSGKFNPICKASGWPLPTNEEMTLVKPDGTVLHPKDFNHTDHFSVAIFTIHRILPPDSG
VWVCSVNTVAGMVEKPFNISVKVLPKPLNAPNVIDTGHNFAVINISSEPYFGDGPIKSKK
LLYKPVNHYEAWQHIQVTNEIVTLNYLEPRTEYELCVQLVRRGEGGEGHPGPVRRFTTAS
IGLPPPRGLNLLPKSQTTLNLTWQPIFPSSEDDFYVEVERRSVQKSDQQNIKVPGNLTSV
LLNNLHPREQYVVRARVNTKAQGEWSEDLTAWTLSDILPPQPENIKISNITHSSAVISWT
ILDGYSISSITIRYKVQGKNEDQHVDVKIKNATITQYQLKGLEPETAYQVDIFAENNIGS
SNPAFSHELVTLPESQAPADLGGGKMLLIAILGSAGMTCLTVLLAFLIILQLKRANVQRR
MAQAFQNVREEPAVQFNSGTLALNRKVKNNPDPTIYPVLDWNDIKFQDVIGEGNFGQVLK
ARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYL
AIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQF
IHRDLAARNILVGENYVAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSD
VWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPY
ERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAEEAA
NT seq 3375 nt NT seq  +upstreamnt  +downstreamnt
atggactctttagccagcttagttctctgtggagtcagcttgctcctttctggaactgtg
gaaggtgccatggacttgatcttgatcaattccctacctcttgtatctgatgctgaaaca
tctctcacctgcattgcctctgggtggcgcccccatgagcccatcaccataggaagggac
tttgaagccttaatgaaccagcaccaggatccgctggaagttactcaagatgtgaccaga
gaatgggctaaaaaagttgtttggaagagagaaaaggctagtaagatcaatggtgcttat
ttctgtgaagggcgagttcgaggagaggcaatcaggatacgaaccatgaagatgcgtcaa
caagcttccttcctaccagctactttaactatgactgtggacaagggagataacgtgaac
atatctttcaaaaaggtattgattaaagaagaagatgcagtgatttacaaaaatggttcc
ttcatccattcagtgccccggcatgaagtacctgatattctagaagtacacctgcctcat
gctcagccccaggatgctggagtgtactcggccaggtatataggaggaaacctcttcacc
tcggccttcaccaggctgatagtccggagatgtgaagcccagaagtggggacctgaatgc
aaccatctctgtactgcttgtatgaacaatggtgtctgccatgaagatactggagaatgc
atttgccctcctgggtttatgggaaggacgtgtgagaaggcttgtgaactgcacacgttt
ggcagaacttgtaaagaaaggtgcagtggacaagagggatgcaagtcttatgtgttctgt
ctccctgacccctatgggtgttcctgtgccacaggctggaagggtctgcagtgcaatgaa
gcatgccaccctggtttttacgggccagattgtaagcttaggtgcagctgcaacaatggg
gagatgtgtgatcgcttccaaggatgtctctgctctccaggatggcaggggctccagtgt
gagagagaaggcataccgaggatgaccccaaagatagtggatttgccagatcatatagaa
gtaaacagtggtaaatttaatcccatttgcaaagcttctggctggccgctacctactaat
gaagaaatgaccctggtgaagccggatgggacagtgctccatccaaaagactttaaccat
acggatcatttctcagtagccatattcaccatccaccggatcctcccccctgactcagga
gtttgggtctgcagtgtgaacacagtggctgggatggtggaaaagcccttcaacatttct
gttaaagttcttccaaagcccctgaatgccccaaacgtgattgacactggacataacttt
gctgtcatcaacatcagctctgagccttactttggggatggaccaatcaaatccaagaag
cttctatacaaacccgttaatcactatgaggcttggcaacatattcaagtgacaaatgag
attgttacactcaactatttggaacctcggacagaatatgaactctgtgtgcaactggtc
cgtcgtggagagggtggggaagggcatcctggacctgtgagacgcttcacaacagcttct
atcggactccctcctccaagaggtctaaatctcctgcctaaaagtcagaccactctaaat
ttgacctggcaaccaatatttccaagctcggaagatgacttttatgttgaagtggagaga
aggtctgtgcaaaaaagtgatcagcagaatattaaagttccaggcaacttgacttcggtg
ctacttaacaacttacatcccagggagcagtacgtggtccgagctagagtcaacaccaag
gcccagggggaatggagtgaagatctcactgcttggacccttagtgacattcttcctcct
caaccagaaaacatcaagatttccaacattacacactcctcagctgtgatttcttggaca
atattggatggctattctatttcttctattactatccgttacaaggttcaaggcaagaat
gaagaccagcacgttgatgtgaagataaagaatgccaccatcactcagtatcagctcaag
ggcctagagcctgaaacagcataccaggtggacatttttgcagagaacaacatagggtca
agcaacccagccttttctcatgaactggtgaccctcccagaatctcaagcaccagcggac
ctcggaggggggaagatgctgcttatagccatccttggctctgctggaatgacctgcctg
actgtgctgttggcctttctgatcatattgcaattgaagagggcaaatgtgcaaaggaga
atggcccaagccttccaaaacgtgagggaagaaccagctgtgcagttcaactcagggact
ctggccctaaacaggaaggtcaaaaacaacccagatcctacaatttatccagtgcttgac
tggaatgacatcaaatttcaagatgtgattggggagggcaattttggccaagttcttaag
gcgcgcatcaagaaggatgggttacggatggatgctgccatcaaaagaatgaaagaatat
gcctccaaagatgatcacagggactttgcaggagaactggaagttctttgtaaacttgga
caccatccaaacatcatcaatctcttaggagcatgtgaacatcgaggctacttgtacctg
gccattgagtacgcgccccatggaaaccttctggacttccttcgcaagagccgtgtgctg
gagacggacccagcatttgccattgccaatagcaccgcgtccacactgtcctcccagcag
ctccttcacttcgctgccgacgtggcccggggcatggactacttgagccaaaaacagttt
atccacagggatctggctgccagaaacattttagttggtgaaaactatgtggcaaaaata
gcagattttggattgtcccgaggtcaagaggtgtatgtgaaaaagacaatgggaaggctc
ccagtgcgctggatggccatcgagtcactgaattacagtgtgtacacaaccaacagtgat
gtatggtcctatggtgtgttactatgggagattgttagcttaggaggcacaccctactgc
gggatgacttgtgcagaactctacgagaagctgccccagggctacagactggagaagccc
ctgaactgtgatgatgaggtgtatgatctaatgagacaatgctggcgggagaagccttat
gagaggccatcatttgcccagatattggtgtccttaaacagaatgttagaggagcgaaag
acctacgtgaataccacgctttatgagaagtttacttatgcaggaattgactgttctgct
gaagaagcggcctag

DBGET integrated database retrieval system