KEGG   Homo sapiens (human): 7013Help
Entry
7013              CDS       T01001                                 

Gene name
TERF1, PIN2, TRBF1, TRF, TRF1, hTRF1-AS, t-TRF1
Definition
(RefSeq) telomeric repeat binding factor 1
  KO
K11110  
telomeric repeat-binding factor 1
Organism
hsa  Homo sapiens (human)
Module
Shelterin complex
Brite
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Telomere proteins
    Shelterin complex
     7013 (TERF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q21.11
AA seq 439 aa AA seqDB search
MAEDVSSAAPSPRGCADGRDADPTEEQMAETERNDEEQFECQELLECQVQVGAPEEEEEE
EEDAGLVAEAEAVAAGWMLDFLCLSLCRAFRDGRSEDFRRTRNSAEAIIHGLSSLTACQL
RTIYICQFLTRIAAGKTLDAQFENDERITPLESALMIWGSIEKEHDKLHEEIQNLIKIQA
IAVCMENGNFKEAEEVFERIFGDPNSHMPFKSKLLMIISQKDTFHSFFQHFSYNHMMEKI
KSYVNYVLSEKSSTFLMKAAAKVVESKRTRTITSQDKPSGNDVEMETEANLDTRKSVSDK
QSAVTESSEGTVSLLRSHKNLFLSKLQHGTQQQDLNKKERRVGTPQSTKKKKESRRATES
RIPVSKSQPVTPEKHRARKRQAWLWEEDKNLRSGVRKYGEGNWSKILLHYKFNNRTSVML
KDRWRTMKKLKLISSDSED
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggatgtttcctcagcggccccgagcccgcggggctgtgcggatggtagggat
gccgaccctactgaggagcagatggcagaaacagagagaaacgacgaggagcagttcgaa
tgccaggaactgctcgagtgccaggtgcaggtgggggcccccgaggaggaggaggaggag
gaggaggacgcgggcctggtggccgaggccgaggccgtggctgccggctggatgctcgat
ttcctctgcctctctctttgccgagctttccgcgacggccgctccgaggacttccgcagg
acccgcaacagcgcagaggctattattcatggactatccagtctaacagcttgccagttg
agaacgatatacatatgtcagtttttgacaagaattgcagcaggaaaaacccttgatgca
cagtttgaaaatgatgaacgaattacacccttggaatcagccctgatgatttggggttca
attgaaaaggaacatgacaaacttcatgaagaaatacagaatttaattaaaattcaggct
atagctgtttgtatggaaaatggcaactttaaagaagcagaagaagtctttgaaagaata
tttggtgatccaaattctcatatgcctttcaaaagcaaattgcttatgataatctctcag
aaagatacatttcattccttttttcaacacttcagctacaaccacatgatggagaaaatt
aagagttatgtgaattatgtgctaagtgaaaaatcatcaacctttctaatgaaggcagcg
gcaaaagtagtagaaagcaaaaggacaagaacaataacttctcaagataaacctagtggt
aatgatgttgaaatggaaactgaagctaatttggatacaagaaaaagtgttagtgacaaa
cagtctgcggtaactgaatcctcagagggtacagtatccttattgaggtctcacaagaat
cttttcttatctaagttgcaacatggaacccagcaacaagaccttaataagaaagaaaga
agagtaggaactcctcaaagtacaaaaaagaaaaaagaaagcagaagagccactgaaagc
agaatacctgtttcaaagagtcagccggtaactcctgaaaaacatcgagctagaaaaaga
caggcatggctttgggaagaagacaagaatttgagatctggcgtgaggaaatatggagag
ggaaactggtctaaaatactgttgcattataaattcaacaaccggacaagtgtcatgtta
aaagacagatggaggaccatgaagaaactaaaactgatttcctcagacagcgaagactga

DBGET integrated database retrieval system