KEGG   Homo sapiens (human): 7014Help
Entry
7014              CDS       T01001                                 

Gene name
TERF2, TRBF2, TRF2
Definition
(RefSeq) telomeric repeat binding factor 2
  KO
K11111  
telomeric repeat-binding factor 2
Organism
hsa  Homo sapiens (human)
Module
Shelterin complex
Brite
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Telomere proteins
    Shelterin complex
     7014 (TERF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16q22.1
AA seq 542 aa AA seqDB search
MAAGAGTAGPASGPGVVRDPAASQPRKRPGREGGEGARRSDTMAGGGGSSDGSGRAAGRR
ASRSSGRARRGRHEPGLGGPAERGAGEARLEEAVNRWVLKFYFHEALRAFRGSRYGDFRQ
IRDIMQALLVRPLGKEHTVSRLLRVMQCLSRIEEGENLDCSFDMEAELTPLESAINVLEM
IKTEFTLTEAVVESSRKLVKEAAVIICIKNKEFEKASKILKKHMSKDPTTQKLRNDLLNI
IREKNLAHPVIQNFSYETFQQKMLRFLESHLDDAEPYLLTMAKKALKSESAASSTGKEDK
QPAPGPVEKPPREPARQLRNPPTTIGMMTLKAAFKTLSGAQDSEAAFAKLDQKDLVLPTQ
ALPASPALKNKRPRKDENESSAPADGEGGSELQPKNKRMTISRLVLEEDSQSTEPSAGLN
SSQEAASAPPSKPTVLNQPLPGEKNPKVPKGKWNSSNGVEEKETWVEEDELFQVQAAPDE
DSTTNITKKQKWTVEESEWVKAGVQKYGEGNWAAISKNYPFVNRTAVMIKDRWRTMKRLG
MN
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgggagccgggacggcgggccccgcttccggcccgggcgtcgtgcgtgaccca
gcggcgtcacagccgaggaagcggcccggccgggagggcggggagggcgcgcggcgatcg
gacacgatggcgggaggaggcgggagtagcgacggcagcgggcgggcagctggcaggcgg
gcgtcccgcagtagcgggcgggcccggcgggggcgccacgagccggggctggggggcccg
gcggagcgcggcgcgggggaggcacggctggaagaggcagtcaatcgctgggtgctcaag
ttctacttccacgaggcgctgcgggcctttcggggtagccggtacggggacttcagacag
atccgggacatcatgcaggctttgcttgtcaggcccttggggaaggagcacaccgtgtcc
cgattgctgcgggttatgcagtgtctgtcgcggattgaagaaggggaaaatttagactgt
tcctttgatatggaggctgagctcacaccactggaatcagctatcaatgtgctggagatg
attaaaacggaatttacactgacagaagcagtggtcgaatccagtagaaaactggtcaag
gaagctgctgtcattatttgtatcaaaaacaaagaatttgaaaaggcttcaaaaattttg
aaaaaacatatgtccaaggaccccacaactcagaagctgagaaatgatctcctgaatatt
attcgagaaaagaacttggcccatcctgttatccagaacttttcatatgagaccttccag
cagaagatgctgcgcttcctggagagccacctggatgacgccgagccctacctcctcacg
atggccaaaaaggctttgaaatctgagtccgctgcctcaagtacagggaaggaagataaa
cagccagcaccagggcctgtggaaaagccacccagagaacccgcaaggcagctacggaat
cctccaaccaccattggaatgatgactctgaaagcagctttcaagactctgtctggtgca
caggattctgaggcagcctttgcaaaactggaccagaaggatctggttcttcctactcaa
gctctcccagcatcaccagccctcaaaaacaagagacccagaaaagatgaaaacgaaagt
tcagccccggctgacggtgagggtggctcggaactgcagcccaagaacaagcgcatgaca
ataagcagattggtcttggaggaggacagccagagtactgagcccagcgcaggcctcaac
tcctcccaggaggccgcttcagcgccaccatccaagcccaccgttctcaaccaacccctc
cctggagagaagaatcccaaagtacccaaaggcaagtggaacagctctaatggggttgaa
gaaaaggagacttgggtggaagaggatgaactgtttcaagttcaggcagcaccagatgaa
gacagtacaaccaatataacaaaaaagcagaagtggactgtagaagaaagcgagtgggtc
aaggctggagtgcagaaatatggggaaggaaactgggctgccatttctaaaaattaccca
tttgttaaccgaacagctgtgatgattaaggatcgctggcggaccatgaaaagacttggc
atgaactga

DBGET integrated database retrieval system