KEGG   Homo sapiens (human): 7018Help
Entry
7018              CDS       T01001                                 

Gene name
TF, PRO1557, PRO2086, TFQTL1
Definition
transferrin
Orthology
K14736  
transferrin
Organism
hsa  Homo sapiens (human)
Pathway
HIF-1 signaling pathway
Mineral absorption
Disease
H01145  
Atransferrinemia
Class
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:hsa04066]
Organismal Systems; Digestive system; Mineral absorption [PATH:hsa04978]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q22.1
AA seq 698 aa AA seqDB search
MRLAVGALLVCAVLGLCLAVPDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVK
KASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVV
KKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPC
ADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRD
QYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKE
FQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTCPEAPTDECKP
VKWCALSHHERLKCDEWSVNSVGKIECVSAETTEDCIAKIMNGEADAMSLDGGFVYIAGK
CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKKSASDLTWDNLKGKKSCHTAVGRTAGWN
IPMGLLYNKINHCRFDEFFSEGCAPGSKKDSSLCKLCMGSGLNLCEPNNKEGYYGYTGAF
RCLVEKGDVAFVKHQTVPQNTGGKNPDPWAKNLNEKDYELLCLDGTRKPVEEYANCHLAR
APNHAVVTRKDKEACVHKILRQQQHLFGSNVTDCSGNFCLFRSETKDLLFRDDTVCLAKL
HDRNTYEKYLGEEYVKAVGNLRKCSTSSLLEACTFRRP
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgaggctcgccgtgggagccctgctggtctgcgccgtcctggggctgtgtctggctgtc
cctgataaaactgtgagatggtgtgcagtgtcggagcatgaggccactaagtgccagagt
ttccgcgaccatatgaaaagcgtcattccatccgatggtcccagtgttgcttgtgtgaag
aaagcctcctaccttgattgcatcagggccattgcggcaaacgaagcggatgctgtgaca
ctggatgcaggtttggtgtatgatgcttacctggctcccaataacctgaagcctgtggtg
gcagagttctatgggtcaaaagaggatccacagactttctattatgctgttgctgtggtg
aagaaggatagtggcttccagatgaaccagcttcgaggcaagaagtcctgccacacgggt
ctaggcaggtccgctgggtggaacatccccataggcttactttactgtgacttacctgag
ccacgtaaacctcttgagaaagcagtggccaatttcttctcgggcagctgtgccccttgt
gcggatgggacggacttcccccagctgtgtcaactgtgtccagggtgtggctgctccacc
cttaaccaatacttcggctactcgggagccttcaagtgtctgaaggatggtgctggggat
gtggcctttgtcaagcactcgactatatttgagaacttggcaaacaaggctgacagggac
cagtatgagctgctttgcctggacaacacccggaagccggtagatgaatacaaggactgc
cacttggcccaggtcccttctcataccgtcgtggcccgaagtatgggcggcaaggaggac
ttgatctgggagcttctcaaccaggcccaggaacattttggcaaagacaaatcaaaagaa
ttccaactattcagctctcctcatgggaaggacctgctgtttaaggactctgcccacggg
tttttaaaagtcccccccaggatggatgccaagatgtacctgggctatgagtatgtcact
gccatccggaatctacgggaaggcacatgcccagaagccccaacagatgaatgcaagcct
gtgaagtggtgtgcgctgagccaccacgagaggctcaagtgtgatgagtggagtgttaac
agtgtagggaaaatagagtgtgtatcagcagagaccaccgaagactgcatcgccaagatc
atgaatggagaagctgatgccatgagcttggatggagggtttgtctacatagcgggcaag
tgtggtctggtgcctgtcttggcagaaaactacaataagagcgataattgtgaggataca
ccagaggcagggtattttgctgtagcagtggtgaagaaatcagcttctgacctcacctgg
gacaatctgaaaggcaagaagtcctgccatacggcagttggcagaaccgctggctggaac
atccccatgggcctgctctacaataagatcaaccactgcagatttgatgaatttttcagt
gaaggttgtgcccctgggtctaagaaagactccagtctctgtaagctgtgtatgggctca
ggcctaaacctgtgtgaacccaacaacaaagagggatactacggctacacaggcgctttc
aggtgtctggttgagaagggagatgtggcctttgtgaaacaccagactgtcccacagaac
actgggggaaaaaaccctgatccatgggctaagaatctgaatgaaaaagactatgagttg
ctgtgccttgatggtaccaggaaacctgtggaggagtatgcgaactgccacctggccaga
gccccgaatcacgctgtggtcacacggaaagataaggaagcttgcgtccacaagatatta
cgtcaacagcagcacctatttggaagcaacgtaactgactgctcgggcaacttttgtttg
ttccggtcggaaaccaaggaccttctgttcagagatgacacagtatgtttggccaaactt
catgacagaaacacatatgaaaaatacttaggagaagaatatgtcaaggctgttggtaac
ctgagaaaatgctccacctcatcactcctggaagcctgcactttccgtagaccttaa

DBGET integrated database retrieval system