KEGG   Homo sapiens (human): 7018Help
Entry
7018              CDS       T01001                                 

Gene name
TF, HEL-S-71p, PRO1557, PRO2086, TFQTL1
Definition
(RefSeq) transferrin
  KO
K14736  transferrin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04066  HIF-1 signaling pathway
hsa04216  Ferroptosis
hsa04978  Mineral absorption
Disease
H01145  Atransferrinemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    7018 (TF)
 Cellular Processes
  Cell growth and death
   04216 Ferroptosis
    7018 (TF)
 Organismal Systems
  Digestive system
   04978 Mineral absorption
    7018 (TF)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   7018 (TF)
  Exosomal proteins of colorectal cancer cells
   7018 (TF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transferrin Phosphonate-bd
Motif
Other DBs
NCBI-GeneID: 7018
NCBI-ProteinID: NP_001054
OMIM: 190000
HGNC: 11740
Ensembl: ENSG00000091513
Vega: OTTHUMG00000150356
Pharos: P02787(Tbio)
UniProt: P02787 A0PJA6 Q06AH7
Structure
PDB: 

Jmol
Position
3q22.1
AA seq 698 aa AA seqDB search
MRLAVGALLVCAVLGLCLAVPDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVK
KASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVV
KKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPC
ADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRD
QYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKE
FQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTCPEAPTDECKP
VKWCALSHHERLKCDEWSVNSVGKIECVSAETTEDCIAKIMNGEADAMSLDGGFVYIAGK
CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKKSASDLTWDNLKGKKSCHTAVGRTAGWN
IPMGLLYNKINHCRFDEFFSEGCAPGSKKDSSLCKLCMGSGLNLCEPNNKEGYYGYTGAF
RCLVEKGDVAFVKHQTVPQNTGGKNPDPWAKNLNEKDYELLCLDGTRKPVEEYANCHLAR
APNHAVVTRKDKEACVHKILRQQQHLFGSNVTDCSGNFCLFRSETKDLLFRDDTVCLAKL
HDRNTYEKYLGEEYVKAVGNLRKCSTSSLLEACTFRRP
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgaggctcgccgtgggagccctgctggtctgcgccgtcctggggctgtgtctggctgtc
cctgataaaactgtgagatggtgtgcagtgtcggagcatgaggccactaagtgccagagt
ttccgcgaccatatgaaaagcgtcattccatccgatggtcccagtgttgcttgtgtgaag
aaagcctcctaccttgattgcatcagggccattgcggcaaacgaagcggatgctgtgaca
ctggatgcaggtttggtgtatgatgcttacctggctcccaataacctgaagcctgtggtg
gcagagttctatgggtcaaaagaggatccacagactttctattatgctgttgctgtggtg
aagaaggatagtggcttccagatgaaccagcttcgaggcaagaagtcctgccacacgggt
ctaggcaggtccgctgggtggaacatccccataggcttactttactgtgacttacctgag
ccacgtaaacctcttgagaaagcagtggccaatttcttctcgggcagctgtgccccttgt
gcggatgggacggacttcccccagctgtgtcaactgtgtccagggtgtggctgctccacc
cttaaccaatacttcggctactcgggagccttcaagtgtctgaaggatggtgctggggat
gtggcctttgtcaagcactcgactatatttgagaacttggcaaacaaggctgacagggac
cagtatgagctgctttgcctggacaacacccggaagccggtagatgaatacaaggactgc
cacttggcccaggtcccttctcataccgtcgtggcccgaagtatgggcggcaaggaggac
ttgatctgggagcttctcaaccaggcccaggaacattttggcaaagacaaatcaaaagaa
ttccaactattcagctctcctcatgggaaggacctgctgtttaaggactctgcccacggg
tttttaaaagtcccccccaggatggatgccaagatgtacctgggctatgagtatgtcact
gccatccggaatctacgggaaggcacatgcccagaagccccaacagatgaatgcaagcct
gtgaagtggtgtgcgctgagccaccacgagaggctcaagtgtgatgagtggagtgttaac
agtgtagggaaaatagagtgtgtatcagcagagaccaccgaagactgcatcgccaagatc
atgaatggagaagctgatgccatgagcttggatggagggtttgtctacatagcgggcaag
tgtggtctggtgcctgtcttggcagaaaactacaataagagcgataattgtgaggataca
ccagaggcagggtattttgctgtagcagtggtgaagaaatcagcttctgacctcacctgg
gacaatctgaaaggcaagaagtcctgccatacggcagttggcagaaccgctggctggaac
atccccatgggcctgctctacaataagatcaaccactgcagatttgatgaatttttcagt
gaaggttgtgcccctgggtctaagaaagactccagtctctgtaagctgtgtatgggctca
ggcctaaacctgtgtgaacccaacaacaaagagggatactacggctacacaggcgctttc
aggtgtctggttgagaagggagatgtggcctttgtgaaacaccagactgtcccacagaac
actgggggaaaaaaccctgatccatgggctaagaatctgaatgaaaaagactatgagttg
ctgtgccttgatggtaccaggaaacctgtggaggagtatgcgaactgccacctggccaga
gccccgaatcacgctgtggtcacacggaaagataaggaagcttgcgtccacaagatatta
cgtcaacagcagcacctatttggaagcaacgtaactgactgctcgggcaacttttgtttg
ttccggtcggaaaccaaggaccttctgttcagagatgacacagtatgtttggccaaactt
catgacagaaacacatatgaaaaatacttaggagaagaatatgtcaaggctgttggtaac
ctgagaaaatgctccacctcatcactcctggaagcctgcactttccgtagaccttaa

DBGET integrated database retrieval system