KEGG   Homo sapiens (human): 7025Help
Entry
7025              CDS       T01001                                 

Gene name
NR2F1, BBOAS, BBSOAS, COUP-TFI, EAR-3, EAR3, ERBAL3, NR2F2, SVP44, TCFCOUP1, TFCOUP1
Definition
(RefSeq) nuclear receptor subfamily 2 group F member 1
  KO
K08547  
COUP transcription factor 1
Organism
hsa  Homo sapiens (human)
Disease
H01378  
Bosch-Boonstra optic atrophy syndrome
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    7025 (NR2F1)
Nuclear receptors [BR:hsa03310]
 2. Hepatocyte nuclear factor 4 like
  2F. COUP-TF like receptor
   7025 (NR2F1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q14
AA seq 423 aa AA seqDB search
MAMVVSSWRDPQDDVAGGNPGGPNPAAQAARGGGGGAGEQQQQAGSGAPHTPQTPGQPGA
PATPGTAGDKGQGPPGSGQSQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTY
TCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLN
GHCYLSGYISLLLRAEPYPTSRYGSQCMQPNNIMGIENICELAARLLFSAVEWARNIPFF
PDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIR
IFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQY
PNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMSI
QCS
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggcaatggtagttagcagctggcgagatccgcaggacgacgtggccgggggcaacccc
ggcggccccaaccccgcagcgcaggcggcccgcggcggcggcggcggcgccggcgagcag
cagcagcaggcgggctcgggcgcgccgcacacgccgcagaccccgggccagcccggagcg
cccgccacccccggcacggcgggggacaagggccagggcccgcccggttcgggccagagc
cagcagcacatcgagtgcgtggtgtgcggggacaagtcgagcggcaagcactacggccaa
ttcacctgcgagggctgcaaaagtttcttcaagaggagcgtccgcaggaacttaacttac
acatgccgtgccaacaggaactgtcccatcgaccagcaccaccgcaaccagtgccaatac
tgccgcctcaagaagtgcctcaaagtgggcatgaggcgggaagcggttcagcgaggaaga
atgcctccaacccagcccaatccaggccagtacgcactcaccaacggggaccccctcaac
ggccactgctacctgtccggctacatctcgctgctgctgcgcgccgagccctaccccacg
tcgcgctacggcagccagtgcatgcagcccaacaacattatgggcatcgagaacatctgc
gagctggccgcgcgcctgctcttcagcgccgtcgagtgggcccgcaacatccccttcttc
ccggatctgcagatcaccgaccaggtgtccctgctacgcctcacctggagcgagctgttc
gtgctcaacgcggcccagtgctctatgccgctgcacgtggcgccgttgctggccgccgcc
ggcctgcatgcctcgcccatgtctgccgaccgcgtcgtggccttcatggaccacatccgc
atcttccaggagcaggtggagaagctcaaggcgctacacgtcgactcagccgagtacagc
tgcctcaaagccatcgtgctgttcacgtcagacgcctgtggcctgtcggatgcggcccac
atcgagagcctgcaggagaagtcgcagtgcgcactggaggagtacgtgaggagccagtac
cccaaccagcccagccgttttggcaaactgctgctgcgactgccctcgctgcgcaccgtg
tcctcctccgtcatcgagcagctcttcttcgtccgtttggtaggtaaaacccccatcgaa
actctcatccgcgatatgttactgtctgggagcagcttcaactggccttacatgtccatc
cagtgctcctag

DBGET integrated database retrieval system