KEGG   Homo sapiens (human): 7026Help
Entry
7026              CDS       T01001                                 

Gene name
NR2F2, ARP1, CHTD4, COUPTFB, COUPTFII, NF-E3, NR2F1, SVP40, TFCOUP2
Definition
(RefSeq) nuclear receptor subfamily 2 group F member 2
  KO
K08548  
COUP transcription factor 2
Organism
hsa  Homo sapiens (human)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    7026 (NR2F2)
Nuclear receptors [BR:hsa03310]
 2. Hepatocyte nuclear factor 4 like
  2F. COUP-TF like receptor
   7026 (NR2F2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q26
AA seq 414 aa AA seqDB search
MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQ
GGPGGPGSDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRN
CPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSG
YISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITD
QVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVE
KLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRF
GKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggcaatggtagtcagcacgtggcgcgacccccaggacgaggtgcccggctcacagggc
agccaggcctcgcaggcgccgcccgtgcccggcccgccgcccggcgccccgcacacgcca
cagacgcccggccaagggggcccagccagcacgccagcccagacggcggccggtggccag
ggcggccctggcggcccgggtagcgacaagcagcagcagcagcaacacatcgagtgcgtg
gtgtgcggagacaagtcgagcggcaagcactacggccagttcacgtgcgagggctgcaag
agcttcttcaagcgcagcgtgcggaggaacctgagctacacgtgccgcgccaaccggaac
tgtcccatcgaccagcaccatcgcaaccagtgccagtactgccgcctcaaaaagtgcctc
aaagtgggcatgagacgggaagcggtgcagaggggcaggatgccgccgacccagccgacc
cacgggcagttcgcgctgaccaacggggatcccctcaactgccactcgtacctgtccgga
tatatttccctgctgttgcgcgcggagccctatcccacgtcgcgcttcggcagccaatgc
atgcagcccaacaacatcatgggtatcgagaacatttgcgaactggccgcgaggatgctc
ttcagcgccgtcgagtgggcccggaacatccccttcttccccgacctgcagatcacggac
caggtggccctgcttcgcctcacctggagcgagctgtttgtgttgaatgcggcgcagtgc
tccatgcccctccacgtcgccccgctcctggccgccgccggcctgcatgcttcgcccatg
tccgccgaccgggtggtcgcctttatggaccacatacggatcttccaagagcaagtggag
aagctcaaggcgctgcacgttgactcagccgagtacagctgcctcaaggccatagtcctg
ttcacctcagatgcctgtggtctctctgatgtagcccatgtggaaagcttgcaggaaaag
tctcagtgtgctttggaagaatacgttaggagccagtaccccaaccagccgacgagattc
ggaaagcttttgcttcgcctcccttccctccgcaccgtctcctcctcagtcatagagcaa
ttgtttttcgtccgtttggtaggtaaaacccccatcgaaaccctcatccgggatatgtta
ctgtccggcagcagttttaactggccgtatatggcaattcaataa

DBGET integrated database retrieval system