KEGG   Homo sapiens (human): 7029Help
Entry
7029              CDS       T01001                                 

Gene name
TFDP2, DP2, RP11-271K21.11
Definition
transcription factor Dp-2 (E2F dimerization partner 2)
Orthology
K09392  
transcription factor Dp-2
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Class
Cellular Processes; Cell growth and death; Cell cycle [PATH:hsa04110]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q23
AA seq 386 aa AA seqDB search
MIISTPQRLTSSGSVLIGSPYTPAPAMVTQTHIAEATGWVPGDRKRARKFIDSDFSESKR
SKKGDKNGKGLRHFSMKVCEKVQRKGTTSYNEVADELVSEFTNSNNHLAADSQAYDQKNI
RRRVYDALNVLMAMNIISKEKKEIKWIGLPTNSAQECQNLEIEKQRRIERIKQKRAQLQE
LLLQQIAFKNLVQRNRQNEQQNQGPPALNSTIQLPFIIINTSRKTVIDCSISSDKFEYLF
NFDNTFEIHDDIEVLKRMGMSFGLESGKCSLEDLKLAKSLVPKALEGYITDISTGPSWLN
QGLLLNSTQSVSNLDLTTGATLPQSSVNQGLCLDAEVALATGQFLAPNSHQSSSAASHCS
ESRGETPCSFNDEDEEDDEEDSSSPE
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgattataagcacaccacagagactaaccagttcaggaagtgttctgattgggagtcca
tatacccctgcaccagcaatggttactcagacacacatagcagaagctactggctgggtc
cctggtgatagaaaacgggctagaaaatttatagactctgatttttcagaaagtaaacga
agcaaaaaaggagataaaaatgggaaaggcttgagacacttttcaatgaaagtgtgtgag
aaagttcaacgaaaaggtacaacatcgtacaatgaagtcgctgatgagctggtgtcagag
ttcaccaattcaaataaccatttggctgctgattcgcaggcttatgatcagaagaacatt
aggcgaagagtttatgatgctttaaatgtgctaatggcaatgaacataatttcaaaggaa
aaaaaagaaatcaagtggattggcctgcctaccaattctgctcaggaatgtcagaatctg
gagatagagaagcagaggcggatagaacggataaagcagaagcgggcccagctgcaagaa
cttctcctacagcaaatcgctttcaaaaacctggtacagagaaatcgacaaaatgagcag
caaaaccagggcccgccggctctgaactctaccattcagctgccattcataatcatcaat
acaagcagaaaaacagtcatagattgcagcatctccagtgacaagtttgagtatcttttc
aattttgacaacacctttgagatccatgatgacatagaagtactaaagcggatgggaatg
tcgtttggcctggagtcaggcaaatgctctctggaggatctgaaacttgcgaaatccctg
gtgccaaaggctttagaaggttatatcacagatatctccacaggaccttcttggttaaat
cagggactacttctgaactctacccaatcagtttcaaatttagacctgaccactggtgcc
accttaccccagtcaagtgtaaaccaagggttatgcttggatgcagaagtggccttagca
actgggcagttcctggccccaaacagtcaccagtccagcagtgcggcctctcactgctcc
gagtcccgaggcgagaccccctgttcgttcaatgatgaagatgaggaagatgatgaggag
gattcctcctccccagaataa

DBGET integrated database retrieval system