KEGG   Homo sapiens (human): 7035Help
Entry
7035              CDS       T01001                                 

Gene name
TFPI, EPI, LACI, TFI, TFPI1
Definition
tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor)
Orthology
K03909  
tissue factor pathway inhibitor
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    7035 (TFPI)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Coagulation and fibrinolysis (General comment) Coagulation, inflammation, complement control
  7035 (TFPI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q32
AA seq 251 aa AA seqDB search
MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADD
GPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQE
KPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPN
GFQVDNYGTQLNAVNNSLTPQSTKVPSLFVTKEGTNDGWKNAAHIYQVFLNAFCIHASMF
FLGLDSISCLC
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgatttacacaatgaagaaagtacatgcactttgggcttctgtatgcctgctgcttaat
cttgcccctgcccctcttaatgctgattctgaggaagatgaagaacacacaattatcaca
gatacggagttgccaccactgaaacttatgcattcattttgtgcattcaaggcggatgat
ggcccatgtaaagcaatcatgaaaagatttttcttcaatattttcactcgacagtgcgaa
gaatttatatatgggggatgtgaaggaaatcagaatcgatttgaaagtctggaagagtgc
aaaaaaatgtgtacaagagataatgcaaacaggattataaagacaacattgcaacaagaa
aagccagatttctgctttttggaagaagatcctggaatatgtcgaggttatattaccagg
tatttttataacaatcagacaaaacagtgtgaacgtttcaagtatggtggatgcctgggc
aatatgaacaattttgagacactggaagaatgcaagaacatttgtgaagatggtccgaat
ggtttccaggtggataattatggaacccagctcaatgctgtgaataactccctgactccg
caatcaaccaaggttcccagcctttttgttacaaaagaaggaacaaatgatggttggaag
aatgcggctcatatttaccaagtctttctgaacgccttctgcattcatgcatccatgttc
tttctaggattggatagcatttcatgcctatgttaa

DBGET integrated database retrieval system