KEGG   Homo sapiens (human): 7035Help
Entry
7035              CDS       T01001                                 

Gene name
TFPI, EPI, LACI, TFI, TFPI1
Definition
(RefSeq) tissue factor pathway inhibitor
  KO
K03909  
tissue factor pathway inhibitor
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    7035 (TFPI)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Coagulation and fibrinolysis (General comment) Coagulation, inflammation, complement control
   7035 (TFPI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P10646(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
2q32.1
AA seq 304 aa AA seqDB search
MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADD
GPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQE
KPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPN
GFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIG
KCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIF
VKNM
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgatttacacaatgaagaaagtacatgcactttgggcttctgtatgcctgctgcttaat
cttgcccctgcccctcttaatgctgattctgaggaagatgaagaacacacaattatcaca
gatacggagttgccaccactgaaacttatgcattcattttgtgcattcaaggcggatgat
ggcccatgtaaagcaatcatgaaaagatttttcttcaatattttcactcgacagtgcgaa
gaatttatatatgggggatgtgaaggaaatcagaatcgatttgaaagtctggaagagtgc
aaaaaaatgtgtacaagagataatgcaaacaggattataaagacaacattgcaacaagaa
aagccagatttctgctttttggaagaagatcctggaatatgtcgaggttatattaccagg
tatttttataacaatcagacaaaacagtgtgaacgtttcaagtatggtggatgcctgggc
aatatgaacaattttgagacactggaagaatgcaagaacatttgtgaagatggtccgaat
ggtttccaggtggataattatggaacccagctcaatgctgtgaataactccctgactccg
caatcaaccaaggttcccagcctttttgaatttcacggtccctcatggtgtctcactcca
gcagacagaggattgtgtcgtgccaatgagaacagattctactacaattcagtcattggg
aaatgccgcccatttaagtacagtggatgtgggggaaatgaaaacaattttacttccaaa
caagaatgtctgagggcatgtaaaaaaggtttcatccaaagaatatcaaaaggaggccta
attaaaaccaaaagaaaaagaaagaagcagagagtgaaaatagcatatgaagaaattttt
gttaaaaatatgtga

DBGET integrated database retrieval system