KEGG   Homo sapiens (human): 7036Help
Entry
7036              CDS       T01001                                 

Gene name
TFR2, HFE3, TFRC2
Definition
(RefSeq) transferrin receptor 2
Organism
hsa  Homo sapiens (human)
Disease
H00211  
Hemochromatosis (HFE)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q22
AA seq 801 aa AA seqDB search
MERLWGLFQRAQQLSPRSSQTVYQRVEGPRKGHLEEEEEDGEEGAETLAHFCPMELRGPE
PLGSRPRQPNLIPWAAAGRRAAPYLVLTALLIFTGAFLLGYVAFRGSCQACGDSVLVVSE
DVNYEPDLDFHQGRLYWSDLQAMFLQFLGEGRLEDTIRQTSLRERVAGSAGMAALTQDIR
AALSRQKLDHVWTDTHYVGLQFPDPAHPNTLHWVDEAGKVGEQLPLEDPDVYCPYSAIGN
VTGELVYAHYGRPEDLQDLRARGVDPVGRLLLVRVGVISFAQKVTNAQDFGAQGVLIYPE
PADFSQDPPKPSLSSQQAVYGHVHLGTGDPYTPGFPSFNQTQFPPVASSGLPSIPAQPIS
ADIASRLLRKLKGPVAPQEWQGSLLGSPYHLGPGPRLRLVVNNHRTSTPINNIFGCIEGR
SEPDHYVVIGAQRDAWGPGAAKSAVGTAILLELVRTFSSMVSNGFRPRRSLLFISWDGGD
FGSVGSTEWLEGYLSVLHLKAVVYVSLDNAVLGDDKFHAKTSPLLTSLIESVLKQVDSPN
HSGQTLYEQVVFTNPSWDAEVIRPLPMDSSAYSFTAFVGVPAVEFSFMEDDQAYPFLHTK
EDTYENLHKVLQGRLPAVAQAVAQLAGQLLIRLSHDRLLPLDFGRYGDVVLRHIGNLNEF
SGDLKARGLTLQWVYSARGDYIRAAEKLRQEIYSSEERDERLTRMYNVRIMRVEFYFLSQ
YVSPADSPFRHIFMGRGDHTLGALLDHLRLLRSNSSGTPGATSSTGFQESRFRRQLALLT
WTLQGAANALSGDVWNIDNNF
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atggagcggctttggggtctattccagagagcgcaacaactgtccccaagatcctctcag
accgtctaccagcgtgtggaaggcccccggaaagggcacctggaggaggaagaggaagac
ggggaggagggggcggagacattggcccacttctgccccatggagctgaggggccctgag
cccctgggctctagacccaggcagccaaacctcattccctgggcggcagcaggacggagg
gctgccccctacctggtcctgacggccctgctgatcttcactggggccttcctactgggc
tacgtcgccttccgagggtcctgccaggcgtgcggagactctgtgttggtggtcagtgag
gatgtcaactatgagcctgacctggatttccaccagggcagactctactggagcgacctc
caggccatgttcctgcagttcctgggggaggggcgcctggaggacaccatcaggcaaacc
agccttcgggaacgggtggcaggctcggccgggatggccgctctgactcaggacattcgc
gcggcgctctcccgccagaagctggaccacgtgtggaccgacacgcactacgtggggctg
caattcccggatccggctcaccccaacaccctgcactgggtcgatgaggccgggaaggtc
ggagagcagctgccgctggaggaccctgacgtctactgcccctacagcgccatcggcaac
gtcacgggagagctggtgtacgcccactacgggcggcccgaagacctgcaggacctgcgg
gccaggggcgtggatccagtgggccgcctgctgctggtgcgcgtgggggtgatcagcttc
gcccagaaggtgaccaatgctcaggacttcggggctcaaggagtgctcatatacccagag
ccagcggacttctcccaggacccacccaagccaagcctgtccagccagcaggcagtgtat
ggacatgtgcacctgggaactggagacccctacacacctggcttcccttccttcaatcaa
acccagttccctccagttgcatcatcaggccttcccagcatcccagcccagcccatcagt
gcagacattgcctcccgcctgctgaggaagctcaaaggccctgtggccccccaagaatgg
caggggagcctcctaggctccccttatcacctgggccccgggccacgactgcggctagtg
gtcaacaatcacaggacctccacccccatcaacaacatcttcggctgcatcgaaggccgc
tcagagccagatcactacgttgtcatcggggcccagagggatgcatggggcccaggagca
gctaaatccgctgtggggacggctatactcctggagctggtgcggaccttttcctccatg
gtgagcaacggcttccggccccgcagaagtctcctcttcatcagctgggacggtggtgac
tttggaagcgtgggctccacggagtggctagagggctacctcagcgtgctgcacctcaaa
gccgtagtgtacgtgagcctggacaacgcagtgctgggggatgacaagtttcatgccaag
accagcccccttctgacaagtctcattgagagtgtcctgaagcaggtggattctcccaac
cacagtgggcagactctctatgaacaggtggtgttcaccaatcccagctgggatgctgag
gtgatccggcccctacccatggacagcagtgcctattccttcacggcctttgtgggagtc
cctgccgtcgagttctcctttatggaggacgaccaggcctacccattcctgcacacaaag
gaggacacttatgagaacctgcataaggtgctgcaaggccgcctgcccgccgtggcccag
gccgtggcccagctcgcagggcagctcctcatccggctcagccacgatcgcctgctgccc
ctcgacttcggccgctacggggacgtcgtcctcaggcacatcgggaacctcaacgagttc
tctggggacctcaaggcccgcgggctgaccctgcagtgggtgtactcggcgcggggggac
tacatccgggcggcggaaaagctgcggcaggagatctacagctcggaggagagagacgag
cgactgacacgcatgtacaacgtgcgcataatgcgggtggagttctacttcctttcccag
tacgtgtcgccagccgactccccgttccgccacatcttcatgggccgtggagaccacacg
ctgggcgccctgctggaccacctgcggctgctgcgctccaacagctccgggacccccggg
gccacctcctccactggcttccaggagagccgtttccggcgtcagctagccctgctcacc
tggacgctgcaaggggcagccaatgcgcttagcggggatgtctggaacattgataacaac
ttctga

DBGET integrated database retrieval system