KEGG   Homo sapiens (human): 7040Help
Entry
7040              CDS       T01001                                 

Gene name
TGFB1, CED, DPD1, LAP, TGFB, TGFbeta
Definition
(RefSeq) transforming growth factor beta 1
  KO
K13375  
transforming growth factor beta-1
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
Cell cycle
Endocytosis
TGF-beta signaling pathway
Osteoclast differentiation
Hippo signaling pathway
Th17 cell differentiation
Intestinal immune network for IgA production
Non-alcoholic fatty liver disease (NAFLD)
AGE-RAGE signaling pathway in diabetic complications
Leishmaniasis
Chagas disease (American trypanosomiasis)
Malaria
Toxoplasmosis
Amoebiasis
Tuberculosis
Hepatitis B
HTLV-I infection
Pathways in cancer
Proteoglycans in cancer
Colorectal cancer
Renal cell carcinoma
Pancreatic cancer
Chronic myeloid leukemia
Inflammatory bowel disease (IBD)
Rheumatoid arthritis
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
Module
TGF-beta signaling
Disease
H00083  
Allograft rejection
H00084  
Graft-versus-host disease
H00434  
Camurati-Engelmann disease
H01593  
Osteoporosis
Drug target
Fresolimumab: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    7040 (TGFB1)
   04350 TGF-beta signaling pathway
    7040 (TGFB1)
   04390 Hippo signaling pathway
    7040 (TGFB1)
   04068 FoxO signaling pathway
    7040 (TGFB1)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7040 (TGFB1)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    7040 (TGFB1)
  Cell growth and death
   04110 Cell cycle
    7040 (TGFB1)
 Organismal Systems
  Immune system
   04659 Th17 cell differentiation
    7040 (TGFB1)
   04672 Intestinal immune network for IgA production
    7040 (TGFB1)
  Development
   04380 Osteoclast differentiation
    7040 (TGFB1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7040 (TGFB1)
   05205 Proteoglycans in cancer
    7040 (TGFB1)
   05210 Colorectal cancer
    7040 (TGFB1)
   05212 Pancreatic cancer
    7040 (TGFB1)
   05220 Chronic myeloid leukemia
    7040 (TGFB1)
   05211 Renal cell carcinoma
    7040 (TGFB1)
  Immune diseases
   05323 Rheumatoid arthritis
    7040 (TGFB1)
   05321 Inflammatiory bowel disease (IBD)
    7040 (TGFB1)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    7040 (TGFB1)
   05414 Dilated cardiomyopathy (DCM)
    7040 (TGFB1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    7040 (TGFB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    7040 (TGFB1)
  Infectious diseases
   05152 Tuberculosis
    7040 (TGFB1)
   05166 HTLV-I infection
    7040 (TGFB1)
   05161 Hepatitis B
    7040 (TGFB1)
   05146 Amoebiasis
    7040 (TGFB1)
   05144 Malaria
    7040 (TGFB1)
   05145 Toxoplasmosis
    7040 (TGFB1)
   05140 Leishmaniasis
    7040 (TGFB1)
   05142 Chagas disease (American trypanosomiasis)
    7040 (TGFB1)
Chaperones and folding catalysts [BR:hsa03110]
 Intramolecular chaperones
  Others
   7040 (TGFB1)
Cytokines [BR:hsa04052]
 TGF-beta family
  TGF-beta subfamily
   7040 (TGFB1)
Cell adhesion molecules and their ligands [BR:hsa04516]
 2. Integrin Family
  Beta1 integrins
   VLA-8
    ITGB1; integrin beta 1 [KO:K05719]
     7040 (TGFB1)
   alpha V beta 1
     7040 (TGFB1)
  Beta5 integrins
   alpha V beta 5
    ITGB5; integrin beta 5 [KO:K06588]
     7040 (TGFB1)
  Beta6 integrins
   alpha V beta 6
    ITGB6; integrin beta 6 [KO:K06589]
     7040 (TGFB1)
  Beta8 integrins
   alpha V beta 8
    ITGB8; integrin beta 8 [KO:K06591]
     7040 (TGFB1)
 6. Sialomucin Family
  GLG1, ESL1; golgi apparatus protein 1 [KO:K06816]
   7040 (TGFB1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   7040 (TGFB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P01137(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.2
AA seq 390 aa AA seqDB search
MPPSGLRLLPLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEI
YDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWR
YLSNRLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFT
TGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYI
DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQA
LEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgccgccctccgggctgcggctgctgccgctgctgctaccgctgctgtggctactggtg
ctgacgcctggccggccggccgcgggactatccacctgcaagactatcgacatggagctg
gtgaagcggaagcgcatcgaggccatccgcggccagatcctgtccaagctgcggctcgcc
agccccccgagccagggggaggtgccgcccggcccgctgcccgaggccgtgctcgccctg
tacaacagcacccgcgaccgggtggccggggagagtgcagaaccggagcccgagcctgag
gccgactactacgccaaggaggtcacccgcgtgctaatggtggaaacccacaacgaaatc
tatgacaagttcaagcagagtacacacagcatatatatgttcttcaacacatcagagctc
cgagaagcggtacctgaacccgtgttgctctcccgggcagagctgcgtctgctgaggctc
aagttaaaagtggagcagcacgtggagctgtaccagaaatacagcaacaattcctggcga
tacctcagcaaccggctgctggcacccagcgactcgccagagtggttatcttttgatgtc
accggagttgtgcggcagtggttgagccgtggaggggaaattgagggctttcgccttagc
gcccactgctcctgtgacagcagggataacacactgcaagtggacatcaacgggttcact
accggccgccgaggtgacctggccaccattcatggcatgaaccggcctttcctgcttctc
atggccaccccgctggagagggcccagcatctgcaaagctcccggcaccgccgagccctg
gacaccaactattgcttcagctccacggagaagaactgctgcgtgcggcagctgtacatt
gacttccgcaaggacctcggctggaagtggatccacgagcccaagggctaccatgccaac
ttctgcctcgggccctgcccctacatttggagcctggacacgcagtacagcaaggtcctg
gccctgtacaaccagcataacccgggcgcctcggcggcgccgtgctgcgtgccgcaggcg
ctggagccgctgcccatcgtgtactacgtgggccgcaagcccaaggtggagcagctgtcc
aacatgatcgtgcgctcctgcaagtgcagctga

KEGG   Homo sapiens (human): 7042Help
Entry
7042              CDS       T01001                                 

Gene name
TGFB2, G-TSF, LDS4, TGF-beta2
Definition
(RefSeq) transforming growth factor beta 2
  KO
K13376  
transforming growth factor beta-2
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
Cell cycle
Endocytosis
TGF-beta signaling pathway
Osteoclast differentiation
Hippo signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Leishmaniasis
Chagas disease (American trypanosomiasis)
Malaria
Toxoplasmosis
Amoebiasis
Tuberculosis
Hepatitis B
HTLV-I infection
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Colorectal cancer
Renal cell carcinoma
Pancreatic cancer
Chronic myeloid leukemia
Inflammatory bowel disease (IBD)
Rheumatoid arthritis
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
Module
TGF-beta signaling
Disease
H00083  
Allograft rejection
H00084  
Graft-versus-host disease
H00800  
Loeys-Dietz syndrome (LDS)
Drug target
Fresolimumab: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    7042 (TGFB2)
   04350 TGF-beta signaling pathway
    7042 (TGFB2)
   04390 Hippo signaling pathway
    7042 (TGFB2)
   04068 FoxO signaling pathway
    7042 (TGFB2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7042 (TGFB2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    7042 (TGFB2)
  Cell growth and death
   04110 Cell cycle
    7042 (TGFB2)
 Organismal Systems
  Development
   04380 Osteoclast differentiation
    7042 (TGFB2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7042 (TGFB2)
   05206 MicroRNAs in cancer
    7042 (TGFB2)
   05205 Proteoglycans in cancer
    7042 (TGFB2)
   05210 Colorectal cancer
    7042 (TGFB2)
   05212 Pancreatic cancer
    7042 (TGFB2)
   05220 Chronic myeloid leukemia
    7042 (TGFB2)
   05211 Renal cell carcinoma
    7042 (TGFB2)
  Immune diseases
   05323 Rheumatoid arthritis
    7042 (TGFB2)
   05321 Inflammatiory bowel disease (IBD)
    7042 (TGFB2)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    7042 (TGFB2)
   05414 Dilated cardiomyopathy (DCM)
    7042 (TGFB2)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    7042 (TGFB2)
  Infectious diseases
   05152 Tuberculosis
    7042 (TGFB2)
   05166 HTLV-I infection
    7042 (TGFB2)
   05161 Hepatitis B
    7042 (TGFB2)
   05146 Amoebiasis
    7042 (TGFB2)
   05144 Malaria
    7042 (TGFB2)
   05145 Toxoplasmosis
    7042 (TGFB2)
   05140 Leishmaniasis
    7042 (TGFB2)
   05142 Chagas disease (American trypanosomiasis)
    7042 (TGFB2)
Cytokines [BR:hsa04052]
 TGF-beta family
  TGF-beta subfamily
   7042 (TGFB2)
Cell adhesion molecules and their ligands [BR:hsa04516]
 2. Integrin Family
  Beta1 integrins
   VLA-8
    ITGB1; integrin beta 1 [KO:K05719]
     7042 (TGFB2)
   alpha V beta 1
     7042 (TGFB2)
  Beta5 integrins
   alpha V beta 5
    ITGB5; integrin beta 5 [KO:K06588]
     7042 (TGFB2)
  Beta6 integrins
   alpha V beta 6
    ITGB6; integrin beta 6 [KO:K06589]
     7042 (TGFB2)
  Beta8 integrins
   alpha V beta 8
    ITGB8; integrin beta 8 [KO:K06591]
     7042 (TGFB2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   7042 (TGFB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P61812(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
1q41
AA seq 414 aa AA seqDB search
MHYCVLSAFLILHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSENAIPP
TFYRPYFRIVRFDVSAMEKNASNLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSP
TQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIP
NKSEELEARFAGIDGTSTYTSGDQKTIKSTRKKNSGKTPHLLLMLLPSYRLESQQTNRRK
KRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQH
SRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgcactactgtgtgctgagcgcttttctgatcctgcatctggtcacggtcgcgctcagc
ctgtctacctgcagcacactcgatatggaccagttcatgcgcaagaggatcgaggcgatc
cgcgggcagatcctgagcaagctgaagctcaccagtcccccagaagactatcctgagccc
gaggaagtccccccggaggtgatttccatctacaacagcaccagggacttgctccaggag
aaggcgagccggagggcggccgcctgcgagcgcgagaggagcgacgaagagtactacgcc
aaggaggtttacaaaatagacatgccgcccttcttcccctccgaaaatgccatcccgccc
actttctacagaccctacttcagaattgttcgatttgacgtctcagcaatggagaagaat
gcttccaatttggtgaaagcagagttcagagtctttcgtttgcagaacccaaaagccaga
gtgcctgaacaacggattgagctatatcagattctcaagtccaaagatttaacatctcca
acccagcgctacatcgacagcaaagttgtgaaaacaagagcagaaggcgaatggctctcc
ttcgatgtaactgatgctgttcatgaatggcttcaccataaagacaggaacctgggattt
aaaataagcttacactgtccctgctgcacttttgtaccatctaataattacatcatccca
aataaaagtgaagaactagaagcaagatttgcaggtattgatggcacctccacatatacc
agtggtgatcagaaaactataaagtccactaggaaaaaaaacagtgggaagaccccacat
ctcctgctaatgttattgccctcctacagacttgagtcacaacagaccaaccggcggaag
aagcgtgctttggatgcggcctattgctttagaaatgtgcaggataattgctgcctacgt
ccactttacattgatttcaagagggatctagggtggaaatggatacacgaacccaaaggg
tacaatgccaacttctgtgctggagcatgcccgtatttatggagttcagacactcagcac
agcagggtcctgagcttatataataccataaatccagaagcatctgcttctccttgctgc
gtgtcccaagatttagaacctctaaccattctctactacattggcaaaacacccaagatt
gaacagctttctaatatgattgtaaagtcttgcaaatgcagctaa

KEGG   Homo sapiens (human): 7043Help
Entry
7043              CDS       T01001                                 

Gene name
TGFB3, ARVD, ARVD1, LDS5, RNHF, TGF-beta3
Definition
(RefSeq) transforming growth factor beta 3
  KO
K13377  
transforming growth factor beta-3
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
Cell cycle
Endocytosis
TGF-beta signaling pathway
Hippo signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Leishmaniasis
Chagas disease (American trypanosomiasis)
Malaria
Toxoplasmosis
Amoebiasis
Tuberculosis
Hepatitis B
HTLV-I infection
Pathways in cancer
Colorectal cancer
Renal cell carcinoma
Pancreatic cancer
Chronic myeloid leukemia
Inflammatory bowel disease (IBD)
Rheumatoid arthritis
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
Module
TGF-beta signaling
Disease
H00083  
Allograft rejection
H00084  
Graft-versus-host disease
H00293  
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
H00431  
Ossification of the posterior longitudinal ligament of spine (OPLL)
H00516  
Isolated orofacial clefts
H01385  
Rienhoff syndrome
Drug target
Fresolimumab: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    7043 (TGFB3)
   04350 TGF-beta signaling pathway
    7043 (TGFB3)
   04390 Hippo signaling pathway
    7043 (TGFB3)
   04068 FoxO signaling pathway
    7043 (TGFB3)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7043 (TGFB3)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    7043 (TGFB3)
  Cell growth and death
   04110 Cell cycle
    7043 (TGFB3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7043 (TGFB3)
   05210 Colorectal cancer
    7043 (TGFB3)
   05212 Pancreatic cancer
    7043 (TGFB3)
   05220 Chronic myeloid leukemia
    7043 (TGFB3)
   05211 Renal cell carcinoma
    7043 (TGFB3)
  Immune diseases
   05323 Rheumatoid arthritis
    7043 (TGFB3)
   05321 Inflammatiory bowel disease (IBD)
    7043 (TGFB3)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    7043 (TGFB3)
   05414 Dilated cardiomyopathy (DCM)
    7043 (TGFB3)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    7043 (TGFB3)
  Infectious diseases
   05152 Tuberculosis
    7043 (TGFB3)
   05166 HTLV-I infection
    7043 (TGFB3)
   05161 Hepatitis B
    7043 (TGFB3)
   05146 Amoebiasis
    7043 (TGFB3)
   05144 Malaria
    7043 (TGFB3)
   05145 Toxoplasmosis
    7043 (TGFB3)
   05140 Leishmaniasis
    7043 (TGFB3)
   05142 Chagas disease (American trypanosomiasis)
    7043 (TGFB3)
Cytokines [BR:hsa04052]
 TGF-beta family
  TGF-beta subfamily
   7043 (TGFB3)
Cell adhesion molecules and their ligands [BR:hsa04516]
 2. Integrin Family
  Beta1 integrins
   VLA-8
    ITGB1; integrin beta 1 [KO:K05719]
     7043 (TGFB3)
   alpha V beta 1
     7043 (TGFB3)
  Beta5 integrins
   alpha V beta 5
    ITGB5; integrin beta 5 [KO:K06588]
     7043 (TGFB3)
  Beta6 integrins
   alpha V beta 6
    ITGB6; integrin beta 6 [KO:K06589]
     7043 (TGFB3)
  Beta8 integrins
   alpha V beta 8
    ITGB8; integrin beta 8 [KO:K06591]
     7043 (TGFB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P10600(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
14q24.3
AA seq 412 aa AA seqDB search
MKMHLQRALVVLALLNFATVSLSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPT
VMTHVPYQVLALYNSTRELLEEMHGEREEGCTQENTESEYYAKEIHKFDMIQGLAEHNEL
AVCPKGITSKVFRFNVSSVEKNRTNLFRAEFRVLRVPNPSSKRNEQRIELFQILRPDEHI
AKQRYIGGKNLPTRGTAEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILE
NIHEVMEIKFKGVDNEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLDNPGQGGQRKKR
ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHST
VLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgcacttgcaaagggctctggtggtcctggccctgctgaactttgccacggtc
agcctctctctgtccacttgcaccaccttggacttcggccacatcaagaagaagagggtg
gaagccattaggggacagatcttgagcaagctcaggctcaccagcccccctgagccaacg
gtgatgacccacgtcccctatcaggtcctggccctttacaacagcacccgggagctgctg
gaggagatgcatggggagagggaggaaggctgcacccaggaaaacaccgagtcggaatac
tatgccaaagaaatccataaattcgacatgatccaggggctggcggagcacaacgaactg
gctgtctgccctaaaggaattacctccaaggttttccgcttcaatgtgtcctcagtggag
aaaaatagaaccaacctattccgagcagaattccgggtcttgcgggtgcccaaccccagc
tctaagcggaatgagcagaggatcgagctcttccagatccttcggccagatgagcacatt
gccaaacagcgctatatcggtggcaagaatctgcccacacggggcactgccgagtggctg
tcctttgatgtcactgacactgtgcgtgagtggctgttgagaagagagtccaacttaggt
ctagaaatcagcattcactgtccatgtcacacctttcagcccaatggagatatcctggaa
aacattcacgaggtgatggaaatcaaattcaaaggcgtggacaatgaggatgaccatggc
cgtggagatctggggcgcctcaagaagcagaaggatcaccacaaccctcatctaatcctc
atgatgattcccccacaccggctcgacaacccgggccaggggggtcagaggaagaagcgg
gctttggacaccaattactgcttccgcaacttggaggagaactgctgtgtgcgccccctc
tacattgacttccgacaggatctgggctggaagtgggtccatgaacctaagggctactat
gccaacttctgctcaggcccttgcccatacctccgcagtgcagacacaacccacagcacg
gtgctgggactgtacaacactctgaaccctgaagcatctgcctcgccttgctgcgtgccc
caggacctggagcccctgaccatcctgtactatgttgggaggacccccaaagtggagcag
ctctccaacatggtggtgaagtcttgtaaatgtagctga

DBGET integrated database retrieval system