KEGG   Homo sapiens (human): 7041Help
Entry
7041              CDS       T01001                                 

Gene name
TGFB1I1, ARA55, HIC-5, HIC5, TSC-5
Definition
(RefSeq) transforming growth factor beta 1 induced transcript 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p11.2
AA seq 461 aa AA seqDB search
MEDLDALLSDLETTTSHMPRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLY
STVCKPRSPKPAAPAAPPFSSSSGVLGTGLCELDRLLQELNATQFNITDEIMSQFPSSKV
ASGEQKEDQSEDKKRPSLPSSPSPGLPKASATSATLELDRLMASLSDFRVQNHLPASGPT
QPPVVSSTNEGSPSPPEPTGKGSLDTMLGLLQSDLSRRGVPTQAKGLCGSCNKPIAGQVV
TALGRAWHPEHFVCGGCSTALGGSSFFEKDGAPFCPECYFERFSPRCGFCNQPIRHKMVT
ALGTHWHPEHFCCVSCGEPFGDEGFHEREGRPYCRRDFLQLFAPRCQGCQGPILDNYISA
LSALWHPDCFVCRECFAPFSGGSFFEHEGRPLCENHFHARRGSLCATCGLPVTGRCVSAL
GRRFHPDHFTCTFCLRPLTKGSFQERAGKPYCQPCFLKLFG
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggaggacctggatgccctgctctctgacctggagactaccacctcgcacatgccaagg
tcaggggctcccaaagagcgccctgcggagcctctcacccctcccccatcctatggccac
cagccacagacagggtctggggagtcttcaggagcctcgggggacaaggaccacctgtac
agcacggtatgcaagcctcggtccccaaagcctgcagccccggcggcccctccattctcc
tcttccagcggtgtcttgggtaccgggctctgtgagctagatcggttgcttcaggaactt
aatgccactcagttcaacatcacagatgaaatcatgtctcagttcccatctagcaaggtg
gcttcaggagagcagaaggaggaccagtctgaagataagaaaagacccagcctcccttcc
agcccgtctcctggcctcccaaaggcttctgccacctcagccactctggagctggataga
ctgatggcctcactctctgacttccgcgttcaaaaccatcttccagcctctgggccaact
cagccaccggtggtgagctccacaaatgagggctccccatccccaccagagccgactggc
aagggcagcctagacaccatgctggggctgctgcagtccgacctcagccgccggggtgtt
cccacccaggccaaaggcctctgtggctcctgcaataaacctattgctgggcaagtggtg
acggctctgggccgcgcctggcaccccgagcacttcgtttgcggaggctgttccaccgcc
ctgggaggcagcagcttcttcgagaaggatggagcccccttctgccccgagtgctacttt
gagcgcttctcgccaagatgtggcttctgcaaccagcccatccgacacaagatggtgacc
gccttgggcactcactggcacccagagcatttctgctgcgtcagttgcggggagcccttc
ggagatgagggtttccacgagcgcgagggccgcccctactgccgccgggacttcctgcag
ctgttcgccccgcgctgccagggctgccagggccccatcctggataactacatctcggcg
ctcagcgcgctctggcacccggactgtttcgtctgcagggaatgcttcgcgcccttctcg
ggaggcagctttttcgagcacgagggccgcccgttgtgcgagaaccacttccacgcacga
cgcggctcgctgtgcgccacgtgtggcctccctgtgaccggccgctgcgtgtcggccctg
ggtcgccgcttccacccggaccacttcacatgcaccttctgcctgcgcccgctcaccaag
gggtccttccaggagcgcgccggcaagccctactgccagccctgcttcctgaagctcttc
ggctga

DBGET integrated database retrieval system