KEGG   Homo sapiens (human): 7043Help
Entry
7043              CDS       T01001                                 

Gene name
TGFB3, ARVD, ARVD1, RNHF, TGF-beta3
Definition
transforming growth factor, beta 3
Orthology
K13377  
transforming growth factor beta-3
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
Cell cycle
Endocytosis
TGF-beta signaling pathway
Hippo signaling pathway
Leishmaniasis
Chagas disease (American trypanosomiasis)
Malaria
Toxoplasmosis
Amoebiasis
Tuberculosis
Hepatitis B
HTLV-I infection
Pathways in cancer
Colorectal cancer
Renal cell carcinoma
Pancreatic cancer
Chronic myeloid leukemia
Inflammatory bowel disease (IBD)
Rheumatoid arthritis
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
Module
TGF-beta signaling
Disease
H00083  
Allograft rejection
H00084  
Graft-versus-host disease
H00293  
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
H00431  
Ossification of the posterior longitudinal ligament of spine (OPLL)
H00516  
Isolated orofacial clefts
H01385  
Rienhoff syndrome
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    7043 (TGFB3)
   04350 TGF-beta signaling pathway
    7043 (TGFB3)
   04390 Hippo signaling pathway
    7043 (TGFB3)
   04068 FoxO signaling pathway
    7043 (TGFB3)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7043 (TGFB3)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    7043 (TGFB3)
  Cell growth and death
   04110 Cell cycle
    7043 (TGFB3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7043 (TGFB3)
   05210 Colorectal cancer
    7043 (TGFB3)
   05212 Pancreatic cancer
    7043 (TGFB3)
   05220 Chronic myeloid leukemia
    7043 (TGFB3)
   05211 Renal cell carcinoma
    7043 (TGFB3)
  Immune diseases
   05323 Rheumatoid arthritis
    7043 (TGFB3)
   05321 Inflammatiory bowel disease (IBD)
    7043 (TGFB3)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    7043 (TGFB3)
   05414 Dilated cardiomyopathy (DCM)
    7043 (TGFB3)
  Infectious diseases
   05152 Tuberculosis
    7043 (TGFB3)
   05166 HTLV-I infection
    7043 (TGFB3)
   05161 Hepatitis B
    7043 (TGFB3)
   05146 Amoebiasis
    7043 (TGFB3)
   05144 Malaria
    7043 (TGFB3)
   05145 Toxoplasmosis
    7043 (TGFB3)
   05140 Leishmaniasis
    7043 (TGFB3)
   05142 Chagas disease (American trypanosomiasis)
    7043 (TGFB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q24
AA seq 412 aa AA seqDB search
MKMHLQRALVVLALLNFATVSLSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPT
VMTHVPYQVLALYNSTRELLEEMHGEREEGCTQENTESEYYAKEIHKFDMIQGLAEHNEL
AVCPKGITSKVFRFNVSSVEKNRTNLFRAEFRVLRVPNPSSKRNEQRIELFQILRPDEHI
AKQRYIGGKNLPTRGTAEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILE
NIHEVMEIKFKGVDNEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLDNPGQGGQRKKR
ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHST
VLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgcacttgcaaagggctctggtggtcctggccctgctgaactttgccacggtc
agcctctctctgtccacttgcaccaccttggacttcggccacatcaagaagaagagggtg
gaagccattaggggacagatcttgagcaagctcaggctcaccagcccccctgagccaacg
gtgatgacccacgtcccctatcaggtcctggccctttacaacagcacccgggagctgctg
gaggagatgcatggggagagggaggaaggctgcacccaggaaaacaccgagtcggaatac
tatgccaaagaaatccataaattcgacatgatccaggggctggcggagcacaacgaactg
gctgtctgccctaaaggaattacctccaaggttttccgcttcaatgtgtcctcagtggag
aaaaatagaaccaacctattccgagcagaattccgggtcttgcgggtgcccaaccccagc
tctaagcggaatgagcagaggatcgagctcttccagatccttcggccagatgagcacatt
gccaaacagcgctatatcggtggcaagaatctgcccacacggggcactgccgagtggctg
tcctttgatgtcactgacactgtgcgtgagtggctgttgagaagagagtccaacttaggt
ctagaaatcagcattcactgtccatgtcacacctttcagcccaatggagatatcctggaa
aacattcacgaggtgatggaaatcaaattcaaaggcgtggacaatgaggatgaccatggc
cgtggagatctggggcgcctcaagaagcagaaggatcaccacaaccctcatctaatcctc
atgatgattcccccacaccggctcgacaacccgggccaggggggtcagaggaagaagcgg
gctttggacaccaattactgcttccgcaacttggaggagaactgctgtgtgcgccccctc
tacattgacttccgacaggatctgggctggaagtgggtccatgaacctaagggctactat
gccaacttctgctcaggcccttgcccatacctccgcagtgcagacacaacccacagcacg
gtgctgggactgtacaacactctgaaccctgaagcatctgcctcgccttgctgcgtgccc
caggacctggagcccctgaccatcctgtactatgttgggaggacccccaaagtggagcag
ctctccaacatggtggtgaagtcttgtaaatgtagctga

DBGET integrated database retrieval system