KEGG   Homo sapiens (human): 7048Help
Entry
7048              CDS       T01001                                 

Gene name
TGFBR2, AAT3, FAA3, LDS1B, LDS2, LDS2B, MFS2, RIIC, TAAD2, TGFR-2, TGFbeta-RII
Definition
(RefSeq) transforming growth factor beta receptor 2
  KO
K04388  
TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
Endocytosis
Cellular senescence
TGF-beta signaling pathway
Osteoclast differentiation
Hippo signaling pathway
Adherens junction
Th17 cell differentiation
Relaxin signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Chagas disease (American trypanosomiasis)
HTLV-I infection
Pathways in cancer
Transcriptional misregulation in cancer
Colorectal cancer
Pancreatic cancer
Chronic myeloid leukemia
Hepatocellular carcinoma
Gastric cancer
Module
TGF-beta signaling
Network
N00063  
TGF-beta signaling pathway
N00064  
Mutation-inactivated TGFBR2 to TGF-beta signaling pathway
N00065  
Mutation-inactivated SMAD2 to TGF-beta signaling pathway
N00134  
EWSR1-FLI1 fusion to transcriptional repression
N00241  
TGFBR2-reduced expression to TGF-beta signaling pathway
N00256  
TGFBR1-reduced expression to TGF-beta signaling pathway
Disease
H00020  
Colorectal cancer
H00048  
Hepatocellular carcinoma
H00800  
Loeys-Dietz syndrome (LDS)
H00801  
Familial thoracic aortic aneurysm and dissection (TAAD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    7048 (TGFBR2)
   04350 TGF-beta signaling pathway
    7048 (TGFBR2)
   04390 Hippo signaling pathway
    7048 (TGFBR2)
   04068 FoxO signaling pathway
    7048 (TGFBR2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7048 (TGFBR2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    7048 (TGFBR2)
  Cell growth and death
   04218 Cellular senescence
    7048 (TGFBR2)
  Cellular community - eukaryotes
   04520 Adherens junction
    7048 (TGFBR2)
 Organismal Systems
  Immune system
   04659 Th17 cell differentiation
    7048 (TGFBR2)
  Endocrine system
   04926 Relaxin signaling pathway
    7048 (TGFBR2)
  Development
   04380 Osteoclast differentiation
    7048 (TGFBR2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7048 (TGFBR2)
   05202 Transcriptional misregulation in cancers
    7048 (TGFBR2)
   05210 Colorectal cancer
    7048 (TGFBR2)
   05212 Pancreatic cancer
    7048 (TGFBR2)
   05225 Hepatocellular carcinoma
    7048 (TGFBR2)
   05226 Gastric cancer
    7048 (TGFBR2)
   05220 Chronic myeloid leukemia
    7048 (TGFBR2)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    7048 (TGFBR2)
  Infectious diseases
   05166 HTLV-I infection
    7048 (TGFBR2)
   05142 Chagas disease (American trypanosomiasis)
    7048 (TGFBR2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     7048 (TGFBR2)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: TKL group
  TGFBR2 family [OT]
   7048 (TGFBR2)
Enzyme-linked receptors [BR:hsa01020]
 Receptor serine/threonine kinases
  Type II TGF-beta receptor
   7048 (TGFBR2)
Cytokine receptors [BR:hsa04050]
 TGF-beta receptors
  Type II TGF-beta receptor
   7048 (TGFBR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P37173(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
3p24.1
AA seq 567 aa AA seqDB search
MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFST
CDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPK
CIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQVTGISLLPPLGVAI
SVIIIFYCYRVNRQQKLSSTWETGKTRKLMEFSEHCAIILEDDRSDISSTCANNINHNTE
LLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLK
HENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKLGSSLARGIAH
LHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVG
TARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVRE
HPCVESMKDNVLRDRGRPEIPSFWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERFSE
LEHLDRLSGRSCSEEKIPEDGSLNTTK
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgggggctgctcaggggcctgtggccgctgcacatcgtcctgtggacgcgtatc
gccagcacgatcccaccgcacgttcagaagtcggttaataacgacatgatagtcactgac
aacaacggtgcagtcaagtttccacaactgtgtaaattttgtgatgtgagattttccacc
tgtgacaaccagaaatcctgcatgagcaactgcagcatcacctccatctgtgagaagcca
caggaagtctgtgtggctgtatggagaaagaatgacgagaacataacactagagacagtt
tgccatgaccccaagctcccctaccatgactttattctggaagatgctgcttctccaaag
tgcattatgaaggaaaaaaaaaagcctggtgagactttcttcatgtgttcctgtagctct
gatgagtgcaatgacaacatcatcttctcagaagaatataacaccagcaatcctgacttg
ttgctagtcatatttcaagtgacaggcatcagcctcctgccaccactgggagttgccata
tctgtcatcatcatcttctactgctaccgcgttaaccggcagcagaagctgagttcaacc
tgggaaaccggcaagacgcggaagctcatggagttcagcgagcactgtgccatcatcctg
gaagatgaccgctctgacatcagctccacgtgtgccaacaacatcaaccacaacacagag
ctgctgcccattgagctggacaccctggtggggaaaggtcgctttgctgaggtctataag
gccaagctgaagcagaacacttcagagcagtttgagacagtggcagtcaagatctttccc
tatgaggagtatgcctcttggaagacagagaaggacatcttctcagacatcaatctgaag
catgagaacatactccagttcctgacggctgaggagcggaagacggagttggggaaacaa
tactggctgatcaccgccttccacgccaagggcaacctacaggagtacctgacgcggcat
gtcatcagctgggaggacctgcgcaagctgggcagctccctcgcccgggggattgctcac
ctccacagtgatcacactccatgtgggaggcccaagatgcccatcgtgcacagggacctc
aagagctccaatatcctcgtgaagaacgacctaacctgctgcctgtgtgactttgggctt
tccctgcgtctggaccctactctgtctgtggatgacctggctaacagtgggcaggtggga
actgcaagatacatggctccagaagtcctagaatccaggatgaatttggagaatgttgag
tccttcaagcagaccgatgtctactccatggctctggtgctctgggaaatgacatctcgc
tgtaatgcagtgggagaagtaaaagattatgagcctccatttggttccaaggtgcgggag
cacccctgtgtcgaaagcatgaaggacaacgtgttgagagatcgagggcgaccagaaatt
cccagcttctggctcaaccaccagggcatccagatggtgtgtgagacgttgactgagtgc
tgggaccacgacccagaggcccgtctcacagcccagtgtgtggcagaacgcttcagtgag
ctggagcatctggacaggctctcggggaggagctgctcggaggagaagattcctgaagac
ggctccctaaacactaccaaatag

DBGET integrated database retrieval system