KEGG   Homo sapiens (human): 7048Help
Entry
7048              CDS       T01001                                 

Gene name
TGFBR2, AAT3, FAA3, LDS1B, LDS2, LDS2B, MFS2, RIIC, TAAD2, TGFR-2, TGFbeta-RII
Definition
transforming growth factor, beta receptor II (70/80kDa) (EC:2.7.11.30)
Orthology
K04388  
TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
Endocytosis
TGF-beta signaling pathway
Osteoclast differentiation
Hippo signaling pathway
Adherens junction
Chagas disease (American trypanosomiasis)
HTLV-I infection
Pathways in cancer
Transcriptional misregulation in cancer
Colorectal cancer
Pancreatic cancer
Chronic myeloid leukemia
Disease
H00020  
Colorectal cancer
H00800  
Loeys-Dietz syndrome (LDS)
H00801  
Familial thoracic aortic aneurysm and dissection (TAAD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    7048 (TGFBR2)
   04350 TGF-beta signaling pathway
    7048 (TGFBR2)
   04390 Hippo signaling pathway
    7048 (TGFBR2)
   04068 FoxO signaling pathway
    7048 (TGFBR2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7048 (TGFBR2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    7048 (TGFBR2)
  Cellular commiunity
   04520 Adherens junction
    7048 (TGFBR2)
 Organismal Systems
  Development
   04380 Osteoclast differentiation
    7048 (TGFBR2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7048 (TGFBR2)
   05202 Transcriptional misregulation in cancers
    7048 (TGFBR2)
   05210 Colorectal cancer
    7048 (TGFBR2)
   05212 Pancreatic cancer
    7048 (TGFBR2)
   05220 Chronic myeloid leukemia
    7048 (TGFBR2)
  Infectious diseases
   05166 HTLV-I infection
    7048 (TGFBR2)
   05142 Chagas disease (American trypanosomiasis)
    7048 (TGFBR2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     7048 (TGFBR2)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: TKL group
  TGFBR2 family [OT]
   7048 (TGFBR2)
Enzyme-linked receptors [BR:hsa01020]
 Receptor serine/threonine kinases
  Type II TGF-beta receptor
   7048 (TGFBR2)
Cytokine receptors [BR:hsa04050]
 TGF-beta receptors
  Type II TGF-beta receptor
   7048 (TGFBR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p22
AA seq 592 aa AA seqDB search
MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSDVEMEAQKDEIICPSCNRTAHPLRHINND
MIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENI
TLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNT
SNPDLLLVIFQVTGISLLPPLGVAISVIIIFYCYRVNRQQKLSSTWETGKTRKLMEFSEH
CAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVA
VKIFPYEEYASWKTEKDIFSDINLKHENILQFLTAEERKTELGKQYWLITAFHAKGNLQE
YLTRHVISWEDLRKLGSSLARGIAHLHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCL
CDFGLSLRLDPTLSVDDLANSGQVGTARYMAPEVLESRMNLENVESFKQTDVYSMALVLW
EMTSRCNAVGEVKDYEPPFGSKVREHPCVESMKDNVLRDRGRPEIPSFWLNHQGIQMVCE
TLTECWDHDPEARLTAQCVAERFSELEHLDRLSGRSCSEEKIPEDGSLNTTK
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgggggctgctcaggggcctgtggccgctgcacatcgtcctgtggacgcgtatc
gccagcacgatcccaccgcacgttcagaagtcggatgtggaaatggaggcccagaaagat
gaaatcatctgccccagctgtaataggactgcccatccactgagacatattaataacgac
atgatagtcactgacaacaacggtgcagtcaagtttccacaactgtgtaaattttgtgat
gtgagattttccacctgtgacaaccagaaatcctgcatgagcaactgcagcatcacctcc
atctgtgagaagccacaggaagtctgtgtggctgtatggagaaagaatgacgagaacata
acactagagacagtttgccatgaccccaagctcccctaccatgactttattctggaagat
gctgcttctccaaagtgcattatgaaggaaaaaaaaaagcctggtgagactttcttcatg
tgttcctgtagctctgatgagtgcaatgacaacatcatcttctcagaagaatataacacc
agcaatcctgacttgttgctagtcatatttcaagtgacaggcatcagcctcctgccacca
ctgggagttgccatatctgtcatcatcatcttctactgctaccgcgttaaccggcagcag
aagctgagttcaacctgggaaaccggcaagacgcggaagctcatggagttcagcgagcac
tgtgccatcatcctggaagatgaccgctctgacatcagctccacgtgtgccaacaacatc
aaccacaacacagagctgctgcccattgagctggacaccctggtggggaaaggtcgcttt
gctgaggtctataaggccaagctgaagcagaacacttcagagcagtttgagacagtggca
gtcaagatctttccctatgaggagtatgcctcttggaagacagagaaggacatcttctca
gacatcaatctgaagcatgagaacatactccagttcctgacggctgaggagcggaagacg
gagttggggaaacaatactggctgatcaccgccttccacgccaagggcaacctacaggag
tacctgacgcggcatgtcatcagctgggaggacctgcgcaagctgggcagctccctcgcc
cgggggattgctcacctccacagtgatcacactccatgtgggaggcccaagatgcccatc
gtgcacagggacctcaagagctccaatatcctcgtgaagaacgacctaacctgctgcctg
tgtgactttgggctttccctgcgtctggaccctactctgtctgtggatgacctggctaac
agtgggcaggtgggaactgcaagatacatggctccagaagtcctagaatccaggatgaat
ttggagaatgttgagtccttcaagcagaccgatgtctactccatggctctggtgctctgg
gaaatgacatctcgctgtaatgcagtgggagaagtaaaagattatgagcctccatttggt
tccaaggtgcgggagcacccctgtgtcgaaagcatgaaggacaacgtgttgagagatcga
gggcgaccagaaattcccagcttctggctcaaccaccagggcatccagatggtgtgtgag
acgttgactgagtgctgggaccacgacccagaggcccgtctcacagcccagtgtgtggca
gaacgcttcagtgagctggagcatctggacaggctctcggggaggagctgctcggaggag
aagattcctgaagacggctccctaaacactaccaaatag

DBGET integrated database retrieval system