KEGG   Homo sapiens (human): 7056Help
Entry
7056              CDS       T01001                                 

Gene name
THBD, AHUS6, BDCA3, CD141, THPH12, THRM, TM
Definition
thrombomodulin
Orthology
K03907  
thrombomodulin
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Disease
H00223  
Inherited thrombophilia
Class
Organismal Systems; Immune system; Complement and coagulation cascades [PATH:hsa04610]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20p11.2
AA seq 575 aa AA seqDB search
MLGVLVLGALALAGLGFPAPAEPQPGGSQCVEHDCFALYPGPATFLNASQICDGLRGHLM
TVRSSVAADVISLLLNGDGGVGRRRLWIGLQLPPGCGDPKRLGPLRGFQWVTGDNNTSYS
RWARLDLNGAPLCGPLCVAVSAAEATVPSEPIWEEQQCEVKADGFLCEFHFPATCRPLAV
EPGAAAAAVSITYGTPFAARGADFQALPVGSSAAVAPLGLQLMCTAPPGAVQGHWAREAP
GAWDCSVENGGCEHACNAIPGAPRCQCPAGAALQADGRSCTASATQSCNDLCEHFCVPNP
DQPGSYSCMCETGYRLAADQHRCEDVDDCILEPSPCPQRCVNTQGGFECHCYPNYDLVDG
ECVEPVDPCFRANCEYQCQPLNQTSYLCVCAEGFAPIPHEPHRCQMFCNQTACPADCDPN
TQASCECPEGYILDDGFICTDIDECENGGFCSGVCHNLPGTFECICGPDSALARHIGTDC
DSGKVDGGDSGSGEPPPSPTPGSTLTPPAVGLVHSGLLIGISIASLCLVVALLALLCHLR
KKQGAARAKMEYKCAAPSKEVVLQHVRTERTPQRL
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgcttggggtcctggtccttggcgcgctggccctggccggcctggggttccccgcaccc
gcagagccgcagccgggtggcagccagtgcgtcgagcacgactgcttcgcgctctacccg
ggccccgcgaccttcctcaatgccagtcagatctgcgacggactgcggggccacctaatg
acagtgcgctcctcggtggctgccgatgtcatttccttgctactgaacggcgacggcggc
gttggccgccggcgcctctggatcggcctgcagctgccacccggctgcggcgaccccaag
cgcctcgggcccctgcgcggcttccagtgggttacgggagacaacaacaccagctatagc
aggtgggcacggctcgacctcaatggggctcccctctgcggcccgttgtgcgtcgctgtc
tccgctgctgaggccactgtgcccagcgagccgatctgggaggagcagcagtgcgaagtg
aaggccgatggcttcctctgcgagttccacttcccagccacctgcaggccactggctgtg
gagcccggcgccgcggctgccgccgtctcgatcacctacggcaccccgttcgcggcccgc
ggagcggacttccaggcgctgccggtgggcagctccgccgcggtggctcccctcggctta
cagctaatgtgcaccgcgccgcccggagcggtccaggggcactgggccagggaggcgccg
ggcgcttgggactgcagcgtggagaacggcggctgcgagcacgcgtgcaatgcgatccct
ggggctccccgctgccagtgcccagccggcgccgccctgcaggcagacgggcgctcctgc
accgcatccgcgacgcagtcctgcaacgacctctgcgagcacttctgcgttcccaacccc
gaccagccgggctcctactcgtgcatgtgcgagaccggctaccggctggcggccgaccaa
caccggtgcgaggacgtggatgactgcatactggagcccagtccgtgtccgcagcgctgt
gtcaacacacagggtggcttcgagtgccactgctaccctaactacgacctggtggacggc
gagtgtgtggagcccgtggacccgtgcttcagagccaactgcgagtaccagtgccagccc
ctgaaccaaactagctacctctgcgtctgcgccgagggcttcgcgcccattccccacgag
ccgcacaggtgccagatgttttgcaaccagactgcctgtccagccgactgcgaccccaac
acccaggctagctgtgagtgccctgaaggctacatcctggacgacggtttcatctgcacg
gacatcgacgagtgcgaaaacggcggcttctgctccggggtgtgccacaacctccccggt
accttcgagtgcatctgcgggcccgactcggcccttgcccgccacattggcaccgactgt
gactccggcaaggtggacggtggcgacagcggctctggcgagcccccgcccagcccgacg
cccggctccaccttgactcctccggccgtggggctcgtgcattcgggcttgctcataggc
atctccatcgcgagcctgtgcctggtggtggcgcttttggcgctcctctgccacctgcgc
aagaagcagggcgccgccagggccaagatggagtacaagtgcgcggccccttccaaggag
gtagtgctgcagcacgtgcggaccgagcggacgccgcagagactctga

DBGET integrated database retrieval system