KEGG   Homo sapiens (human): 7059Help
Entry
7059              CDS       T01001                                 

Gene name
THBS3, TSP3
Definition
thrombospondin 3
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:hsa04512]
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Human Diseases; Infectious diseases; Malaria [PATH:hsa05144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q21
AA seq 947 aa AA seqDB search
METQELRGALALLLLCFFTSASQDLQVIDLLTVGESRQMVAVAEKIRTALLTAGDIYLLS
TFRLPPKQGGVLFGLYSRQDNTRWLEASVVGKINKVLVRYQREDGKVHAVNLQQAGLADG
RTHTVLLRLRGPSRPSPALHLYVDCKLGDQHAGLPALAPIPPAEVDGLEIRTGQKAYLRM
QGFVESMKIILGGSMARVGALSECPFQGDESIHSAGEQTKALVTQLTLFNQILVELRDDI
RDQVKEMSLIRNTIMECQVCGFHEQRSHCSPNPCFRGVDCMEVYEYPGYRCGPCPPGLQG
NGTHCSDINECAHADPCFPGSSCINTMPGFHCEACPRGYKGTQVSGVGIDYARASKQVCN
DIDECNDGNNGGCDPNSICTNTVGSFKCGPCRLGFLGNQSQGCLPARTCHSPAHSPCHIH
AHCLFERNGAVSCQCNVGWAGNGNVCGTDTDIDGYPDQALPCMDNNKHCKQDNCLLTPNS
GQEDADNDGVGDQCDDDADGDGIKNVEDNCRLFPNKDQQNSDTDSFGDACDNCPNVPNND
QKDTDGNGEGDACDNDVDGDGIPNGLDNCPKVPNPLQTDRDEDGVGDACDSCPEMSNPTQ
TDADSDLVGDVCDTNEDSDGDGHQDTKDNCPQLPNSSQLDSDNDGLGDECDGDDDNDGIP
DYVPPGPDNCRLVPNPNQKDSDGNGVGDVCEDDFDNDAVVDPLDVCPESAEVTLTDFRAY
QTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDD
DYAGFLFSYQDSGRFYVVMWKQTEQTYWQATPFRAVAQPGLQLKAVTSVSGPGEHLRNAL
WHTGHTPDQVRLLWTDPRNVGWRDKTSYRWQLLHRPQVGYIRVKLYEGPQLVADSGVIID
TSMRGGRLGVFCFSQENIIWSNLQYRCNDTVPEDFEPFRRQLLQGRV
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atggagacgcaggaacttcggggggccctggctcttctcctcctttgctttttcacatct
gccagtcaggatctgcaggtaattgacctgctgactgtgggcgagtctcggcagatggta
gctgtggcagagaagatccggacagccttgctcactgctggggacatctacctcttatcc
accttccgcctgccccccaagcagggtggtgtcctctttggcctctattctcgccaagac
aacactcgatggctggaggcctctgttgtaggcaagatcaacaaagtactggtgcgatac
cagcgggaggatggcaaagtccacgccgtgaacctacagcaagcgggcctggctgatggg
cgcacacacacagttctcctgcgactccgaggtccctccagacccagccctgccctacat
ctctacgtggactgcaaactgggtgaccaacatgcaggccttccagcactggcccccatt
cctccagcggaggtcgatgggctggagattaggactggacagaaggcgtatttgaggatg
cagggctttgtggaatctatgaaaattattctgggtgggtccatggcccgggtaggagcc
ctgagtgagtgtccattccaaggggacgagtccatccacagtgcaggggagcagaccaag
gcgctggtcacccaactcaccctcttcaaccagatcctggtggagctgcgggatgatata
cgagaccaggtgaaggaaatgtccctgatccgaaacaccattatggagtgtcaggtgtgc
ggcttccatgagcagcgttcccactgcagccccaatccctgcttccgaggtgtggactgc
atggaagtgtacgagtacccaggctaccgctgtgggccctgcccccctggcctgcagggc
aacggcacccactgcagtgacatcaatgagtgtgctcacgctgacccctgtttcccgggc
tccagctgcatcaacaccatgcccggcttccactgtgaggcctgtcctcgagggtacaag
ggcacacaggtgtctggtgtgggcattgactatgcccgggccagcaaacaggtctgcaat
gacatcgatgaatgcaacgatggcaacaatggtggctgtgacccaaactccatctgcacc
aacactgtgggctctttcaagtgtggtccctgccgcctgggtttcctgggcaaccagagc
cagggctgcctcccagcccggacctgccacagcccagcccacagcccctgccacatccat
gctcactgtctctttgaacgcaatggtgcagtgtcctgccagtgtaacgtgggctgggct
gggaatgggaacgtgtgtgggactgacacagacatcgatggctacccagaccaagcactg
ccctgcatggacaacaacaaacactgcaaacaggacaactgccttttgacacccaactct
gggcaggaagatgctgataatgatggtgtgggggaccagtgtgatgatgatgctgatggg
gatgggatcaagaatgttgaggacaactgccggctgttccccaacaaagaccagcagaac
tcagatacagattcatttggtgatgcctgtgacaattgccccaacgttcccaacaatgac
cagaaggacacagatggcaatggggaaggagatgcctgtgacaacgacgtggatggggat
ggcatccccaatggattggacaattgccctaaagtccccaacccactacagacagacagg
gatgaggacggggtgggagatgcttgcgacagctgccctgaaatgagcaatcctacccag
acagatgcagacagcgacctggtgggggatgtctgtgatactaatgaagacagcgatggg
gatgggcatcaggacaccaaggacaactgcccacagctgccaaatagctcccagctggac
tctgataacgatggacttggagatgagtgtgatggggatgatgacaatgatggcatccca
gattatgtgcctcctggtcccgataactgccgcctggtacccaatcccaatcagaaggac
tcagatggcaatggcgttggtgatgtgtgtgaggatgactttgacaatgatgctgtggtc
gaccccctggatgtgtgtcctgaaagtgcagaggtaacgcttacggattttcgggcctat
cagaccgtcgtcctggatcctgagggtgatgctcagattgacccaaactgggttgtgctc
aaccagggcatggaaatcgttcagaccatgaacagtgaccctggcttggcagttggatac
acggccttcaatggtgtggactttgaaggcaccttccatgtgaacacagtgactgatgat
gactacgcaggctttctcttcagttatcaagacagtggccgcttctacgtagtcatgtgg
aagcagaccgagcagacctactggcaggctacacccttccgggcggttgcccagcccggg
ctgcagctcaaggcagtgacatcagtgtctggcccaggtgagcacctccgaaatgccctg
tggcatactggccacacccctgatcaggtacgactgctgtggacagacccacgaaatgtg
ggctggcgggacaagacctcctatcgctggcagcttctgcaccggcctcaagttggctac
attcgggtgaagctctatgagggaccccagcttgtggcggattctggggtgatcattgac
acatccatgcgaggggggcgtcttggtgtattctgcttctcccaagaaaacataatttgg
tccaatctccagtatcgatgcaatgacacagtgcctgaggactttgagccattccggagg
cagctgctccagggaagggtgtga

DBGET integrated database retrieval system