KEGG   Homo sapiens (human): 706Help
Entry
706               CDS       T01001                                 

Gene name
TSPO, BPBS, BZRP, DBI, IBP, MBR, PBR, PBS, PKBS, PTBR, mDRC, pk18
Definition
translocator protein (18kDa)
Orthology
K05770  
benzodiazapine receptor
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    706 (TSPO)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    706 (TSPO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q13.31
AA seq 169 aa AA seqDB search
MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA
ATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggccccgccctgggtgcccgccatgggcttcacgctggcgcccagcctggggtgcttc
gtgggctcccgctttgtccacggcgagggtctccgctggtacgccggcctgcagaagccc
tcgtggcacccgccccactgggtgctgggccctgtctggggcacgctctactcagccatg
gggtacggctcctacctggtctggaaagagctgggaggcttcacagagaaggctgtggtt
cccctgggcctctacactgggcagctggccctgaactgggcatggccccccatcttcttt
ggtgcccgacaaatgggctgggccttggtggatctcctgctggtcagtggggcggcggca
gccactaccgtggcctggtaccaggtgagcccgctggccgcccgcctgctctacccctac
ctggcctggctggccttcacgaccacactcaactactgcgtatggcgggacaaccatggc
tggcgtgggggacggcggctgccagagtga

DBGET integrated database retrieval system