KEGG   Homo sapiens (human): 7064Help
Entry
7064              CDS       T01001                                 

Gene name
THOP1, EP24.15, MEPD_HUMAN, MP78, TOP
Definition
thimet oligopeptidase 1 (EC:3.4.24.15)
Orthology
K01392  
thimet oligopeptidase [EC:3.4.24.15]
Organism
hsa  Homo sapiens (human)
Pathway
Renin-angiotensin system
African trypanosomiasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04614 Renin-angiotensin system
    7064 (THOP1)
 Human Diseases
  Infectious diseases
   05143 African trypanosomiasis
    7064 (THOP1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.15  thimet oligopeptidase
     7064 (THOP1)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M3
   7064 (THOP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.3
AA seq 689 aa AA seqDB search
MKPPAACAGDMADAASPCSVVNDLRWDLSAQQIEERTRELIEQTKRVYDQVGTQEFEDVS
YESTLKALADVEVTYTVQRNILDFPQHVSPSKDIRTASTEADKKLSEFDVEMSMREDVYQ
RIVWLQEKVQKDSLRPEAARYLERLIKLGRRNGLHLPRETQENIKRIKKKLSLLCIDFNK
NLNEDTTFLPFTLQELGGLPEDFLNSLEKMEDGKLKVTLKYPHYFPLLKKCHVPETRRKV
EEAFNCRCKEENCAILKELVTLRAQKSRLLGFHTHADYVLEMNMAKTSQTVATFLDELAQ
KLKPLGEQERAVILELKRAECERRGLPFDGRIRAWDMRYYMNQVEETRYCVDQNLLKEYF
PVQVVTHGLLGIYQELLGLAFHHEEGASAWHEDVRLYTARDAASGEVVGKFYLDLYPREG
KYGHAACFGLQPGCLRQDGSRQIAIAAMVANFTKPTADAPSLLQHDEVETYFHEFGHVMH
QLCSQAEFAMFSGTHVERDFVEAPSQMLENWVWEQEPLLRMSRHYRTGSAVPRELLEKLI
ESRQANTGLFNLRQIVLAKVDQALHTQTDADPAEEYARLCQEILGVPATPGTNMPATFGH
LAGGYDAQYYGYLWSEVYSMDMFHTRFKQEGVLNSKVGMDYRSCILRPGGSEDASAMLRR
FLGRDPKQDAFLLSKGLQVGGCEPEPQVC
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgaagccccccgcagcctgtgcaggagacatggcggacgcagcatctccgtgctctgtg
gtaaacgacctgcggtgggacctgagtgcccagcagatagaggagcgcaccagggagctc
atcgagcagaccaagcgcgtgtatgaccaggttggcacccaggagtttgaggacgtgtcc
tacgagagcacgctcaaggcgctggccgatgtggaggtcacctacacagttcagaggaat
atccttgacttcccccagcatgtttccccctccaaggacatccggacagccagcacagag
gccgacaagaagctctctgagttcgacgtggagatgagcatgagggaggacgtgtaccag
aggatcgtgtggctccaggagaaagttcagaaggactcactgaggcccgaggctgcgcgg
tacctggagcggctaatcaagctgggccggagaaatgggcttcacctccccagagagact
caggaaaacatcaaacgcatcaagaagaagctgagccttctgtgcatcgacttcaacaag
aacctgaacgaggacacgaccttcctgcccttcacgctccaggagctaggagggctcccc
gaggactttctgaactccctggagaagatggaggacggcaagttgaaggtcaccctcaag
tacccccattacttccccctcctgaagaaatgccacgtgcctgagaccaggaggaaagtg
gaggaggccttcaactgccggtgcaaggaggagaactgcgctatcctcaaggagctggtg
acgctgcgggcccagaagtcccgcctgctggggttccacacgcacgccgactatgtcctg
gagatgaacatggccaagaccagccagaccgtggccaccttcctagatgagctggcgcag
aagctgaagcccctgggggagcaggagcgtgcggtgattctggagctgaagcgtgcggag
tgcgagcgccggggcctgcccttcgacggccgcatccgtgcctgggacatgcgctactac
atgaaccaggtggaggagacgcgctactgcgtggaccagaacctgctcaaggagtacttc
cccgtgcaggtggtcacgcacgggctgctgggcatctaccaggagctcctggggctggcc
ttccaccacgaggagggcgccagtgcctggcatgaggacgtgcggctctacaccgcgagg
gacgcggcctcgggggaggtggtcggcaagttctacctggacctgtacccgcgggaagga
aagtacgggcacgcggcctgctttggcctgcagcccggctgcctgcggcaggatgggagc
cgccagatcgccatcgcggccatggtggccaacttcaccaagcccacagccgacgcgccc
tcgctgctgcagcatgacgaggtggagacctacttccatgagtttggccacgtgatgcac
cagctctgctcccaggcggagttcgccatgttcagcgggacccacgtggagcgggacttt
gtggaggcgccgtcgcagatgctggagaactgggtgtgggagcaggagccgctgctgcgg
atgtcgcggcactaccgcacaggcagcgccgtgccccgggagctcctggagaagctcatt
gagtcccggcaggccaacacaggcctcttcaacctgcgccagatcgtcctcgccaaggtg
gaccaggccctgcacacgcagacggacgcagaccccgccgaggagtatgcgcggctctgc
caggagatcctcggggtcccggccacgccaggaaccaacatgcctgcaaccttcggccat
ctggcaggtggctacgacgcccagtactacgggtacctgtggagcgaggtgtattccatg
gacatgttccacacgcgcttcaagcaggagggtgtcctgaacagcaaggttggcatggat
tacagaagctgcatcctgagacccggcggttccgaggatgccagcgccatgctgaggcgc
ttcctgggccgtgaccccaagcaggacgccttcctcctgagcaaggggctgcaggtcggg
ggctgcgagcccgagccgcaggtctgctga

DBGET integrated database retrieval system