KEGG   Homo sapiens (human): 7067Help
Entry
7067              CDS       T01001                                 

Gene name
THRA, AR7, CHNG6, EAR7, ERB-T-1, ERBA, ERBA1, NR1A1, THRA1, THRA2, c-ERBA-1
Definition
thyroid hormone receptor, alpha
Orthology
K05547  
thyroid hormone receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Thyroid hormone signaling pathway
Drug target
Tiratricol: 
Levothyroxine sodium: 
Liothyronine sodium: 
Other: 
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:hsa04919]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q11.2
AA seq 451 aa AA seqDB search
MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCSLKTSMSGYIPSYLDKDEQCVVCGDKA
TGYHYRCITCEGCKGFFRRTIQKNLHPTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGM
AMDLVLDDSKRVAKRKLIEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHIATEAHRSTNA
QGSHWKQRRKFLPDDIGQSPIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFS
ELPCEDQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAVKREQLKNGGLGVVSDAIF
ELGKSLSAFNLDDTEVALLQAVLLMSTDRSGLLCVDKIEKSQEAYLLAFEHYVNHRKHNI
PHFWPKLLMKGPQVRQLEQQLGEAGSLQGPVLQHQSPKSPQQRLLELLHRSGILHARAVC
GEDDSSEADSPSSSEEEPEVCEDLAGNAASP
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggaacagaagccaagcaaggtggagtgtgggtcagacccagaggagaacagtgccagg
tcaccagatggaaagcgaaaaagaaagaacggccaatgttccctgaaaaccagcatgtca
gggtatatccctagttacctggacaaagacgagcagtgtgtcgtgtgtggggacaaggca
actggttatcactaccgctgtatcacttgtgagggctgcaagggcttctttcgccgcaca
atccagaagaacctccatcccacctattcctgcaaatatgacagctgctgtgtcattgac
aagatcacccgcaatcagtgccagctgtgccgcttcaagaagtgcatcgccgtgggcatg
gccatggacttggttctagatgactcgaagcgggtggccaagcgtaagctgattgagcag
aaccgggagcggcggcggaaggaggagatgatccgatcactgcagcagcgaccagagccc
actcctgaagagtgggatctgatccacattgccacagaggcccatcgcagcaccaatgcc
cagggcagccattggaaacagaggcggaaattcctgcccgatgacattggccagtcaccc
attgtctccatgccggacggagacaaggtggacctggaagccttcagcgagtttaccaag
atcatcaccccggccatcacccgtgtggtggactttgccaaaaaactgcccatgttctcc
gagctgccttgcgaagaccagatcatcctcctgaaggggtgctgcatggagatcatgtcc
ctgcgggcggctgtccgctacgaccctgagagcgacaccctgacgctgagtggggagatg
gctgtcaagcgggagcagctcaagaatggcggcctgggcgtagtctccgacgccatcttt
gaactgggcaagtcactctctgcctttaacctggatgacacggaagtggctctgctgcag
gctgtgctgctaatgtcaacagaccgctcgggcctgctgtgtgtggacaagatcgagaag
agtcaggaggcgtacctgctggcgttcgagcactacgtcaaccaccgcaaacacaacatt
ccgcacttctggcccaagctgctgatgaagggtccgcaggtccggcagcttgagcagcag
cttggtgaagcgggaagtctccaagggccggttcttcagcaccagagcccgaagagcccg
cagcagcgtctcctggagctgctccaccgaagcggaattctccatgcccgagcggtctgt
ggggaagacgacagcagtgaggcggactccccgagctcctctgaggaggaaccggaggtc
tgcgaggacctggcaggcaatgcagcctctccctga

DBGET integrated database retrieval system