KEGG   Homo sapiens (human): 7067Help
Entry
7067              CDS       T01001                                 

Gene name
THRA, AR7, CHNG6, EAR7, ERB-T-1, ERBA, ERBA1, NR1A1, THRA1, THRA2, c-ERBA-1
Definition
(RefSeq) thyroid hormone receptor, alpha
  KO
K05547  
thyroid hormone receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Thyroid hormone signaling pathway
Drug target
Dried thyroid: 
Levothyroxine (DG00510): 
Levothyroxine sodium: 
Liothyronine (DG01372): 
Liothyronine sodium: 
Liotrix: 
Thyroid: 
Tiratricol: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    7067 (THRA)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    7067 (THRA)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    7067 (THRA)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1A. Thyroid hormone receptor (THR)
   7067 (THRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q11.2
AA seq 490 aa AA seqDB search
MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCSLKTSMSGYIPSYLDKDEQCVVCGDKA
TGYHYRCITCEGCKGFFRRTIQKNLHPTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGM
AMDLVLDDSKRVAKRKLIEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHIATEAHRSTNA
QGSHWKQRRKFLPDDIGQSPIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFS
ELPCEDQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAVKREQLKNGGLGVVSDAIF
ELGKSLSAFNLDDTEVALLQAVLLMSTDRSGLLCVDKIEKSQEAYLLAFEHYVNHRKHNI
PHFWPKLLMKEREVQSSILYKGAAAEGRPGGSLGVHPEGQQLLGMHVVQGPQVRQLEQQL
GEAGSLQGPVLQHQSPKSPQQRLLELLHRSGILHARAVCGEDDSSEADSPSSSEEEPEVC
EDLAGNAASP
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggaacagaagccaagcaaggtggagtgtgggtcagacccagaggagaacagtgccagg
tcaccagatggaaagcgaaaaagaaagaacggccaatgttccctgaaaaccagcatgtca
gggtatatccctagttacctggacaaagacgagcagtgtgtcgtgtgtggggacaaggca
actggttatcactaccgctgtatcacttgtgagggctgcaagggcttctttcgccgcaca
atccagaagaacctccatcccacctattcctgcaaatatgacagctgctgtgtcattgac
aagatcacccgcaatcagtgccagctgtgccgcttcaagaagtgcatcgccgtgggcatg
gccatggacttggttctagatgactcgaagcgggtggccaagcgtaagctgattgagcag
aaccgggagcggcggcggaaggaggagatgatccgatcactgcagcagcgaccagagccc
actcctgaagagtgggatctgatccacattgccacagaggcccatcgcagcaccaatgcc
cagggcagccattggaaacagaggcggaaattcctgcccgatgacattggccagtcaccc
attgtctccatgccggacggagacaaggtggacctggaagccttcagcgagtttaccaag
atcatcaccccggccatcacccgtgtggtggactttgccaaaaaactgcccatgttctcc
gagctgccttgcgaagaccagatcatcctcctgaaggggtgctgcatggagatcatgtcc
ctgcgggcggctgtccgctacgaccctgagagcgacaccctgacgctgagtggggagatg
gctgtcaagcgggagcagctcaagaatggcggcctgggcgtagtctccgacgccatcttt
gaactgggcaagtcactctctgcctttaacctggatgacacggaagtggctctgctgcag
gctgtgctgctaatgtcaacagaccgctcgggcctgctgtgtgtggacaagatcgagaag
agtcaggaggcgtacctgctggcgttcgagcactacgtcaaccaccgcaaacacaacatt
ccgcacttctggcccaagctgctgatgaaggagagagaagtgcagagttcgattctgtac
aagggggcagcggcagaaggccggccgggcgggtcactgggcgtccacccggaaggacag
cagcttctcggaatgcatgttgttcagggtccgcaggtccggcagcttgagcagcagctt
ggtgaagcgggaagtctccaagggccggttcttcagcaccagagcccgaagagcccgcag
cagcgtctcctggagctgctccaccgaagcggaattctccatgcccgagcggtctgtggg
gaagacgacagcagtgaggcggactccccgagctcctctgaggaggaaccggaggtctgc
gaggacctggcaggcaatgcagcctctccctga

DBGET integrated database retrieval system