KEGG   Homo sapiens (human): 7068Help
Entry
7068              CDS       T01001                                 

Gene name
THRB, C-ERBA-2, C-ERBA-BETA, ERBA2, GRTH, NR1A2, PRTH, THR1, THRB1, THRB2
Definition
(RefSeq) thyroid hormone receptor beta
  KO
K08362  
thyroid hormone receptor beta
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Thyroid hormone signaling pathway
Disease
H00249  
Thyroid hormone resistance syndrome
Drug target
Tiratricol: 
Levothyroxine sodium: 
Liothyronine sodium: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    7068 (THRB)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    7068 (THRB)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    7068 (THRB)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1A. Thyroid hormone receptor (THR)
   7068 (THRB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p24.2
AA seq 461 aa AA seqDB search
MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLKNEQSSPHLIQ
TTWTSSIFHLDHDDVNDQSVSSAQTFQTEEKKCKGYIPSYLDKDELCVVCGDKATGYHYR
CITCEGCKGFFRRTIQKNLHPSYSCKYEGKCVIDKVTRNQCQECRFKKCIYVGMATDLVL
DDSKRLAKRKLIEENREKRRREELQKSIGHKPEPTDEEWELIKTVTEAHVATNAQGSHWK
QKRKFLPEDIGQAPIVNAPEGGKVDLEAFSHFTKIITPAITRVVDFAKKLPMFCELPCED
QIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSL
SSFNLDDTEVALLQAVLLMSSDRPGLACVERIEKYQDSFLLAFEHYINYRKHHVTHFWPK
LLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgactcccaacagtatgacagaaaatggccttacagcctgggacaaaccgaagcactgt
ccagaccgagaacacgactggaagctagtaggaatgtctgaagcctgcctacataggaag
agccattcagagaggcgcagcacgttgaaaaatgaacagtcgtcgccacatctcatccag
accacttggactagctcaatattccatctggaccatgatgatgtgaacgaccagagtgtc
tcaagtgcccagaccttccaaacggaggagaagaaatgtaaagggtacatccccagttac
ttagacaaggacgagctctgtgtagtgtgtggtgacaaagccaccgggtatcactaccgc
tgtatcacgtgtgaaggctgcaagggtttctttagaagaaccattcagaaaaatctccat
ccatcctattcctgtaaatatgaaggaaaatgtgtcatagacaaagtcacgcgaaatcag
tgccaggaatgtcgctttaagaaatgcatctatgttggcatggcaacagatttggtgctg
gatgacagcaagaggctggccaagaggaagctgatagaggagaaccgggagaaaagacgg
cgggaagagctgcagaagtccatcgggcacaagccagagcccacagacgaggaatgggag
ctcatcaaaactgtcaccgaagcccatgtggcgaccaacgcccaaggcagccactggaag
caaaaacggaaattcctgccagaagacattggacaagcaccaatagtcaatgccccagaa
ggtggaaaggttgacttggaagccttcagccattttacaaaaatcatcacaccagcaatt
accagagtggtggattttgccaaaaagttgcctatgttttgtgagctgccatgtgaagac
cagatcatcctcctcaaaggctgctgcatggagatcatgtcccttcgcgctgctgtgcgc
tatgacccagaaagtgagactttaaccttgaatggggaaatggcagtgacacggggccag
ctgaaaaatgggggtcttggggtggtgtcagacgccatctttgacctgggcatgtctctg
tcttctttcaacctggatgacactgaagtagccctccttcaggccgtcctgctgatgtct
tcagatcgcccggggcttgcctgtgttgagagaatagaaaagtaccaagatagtttcctg
ctggcctttgaacactatatcaattaccgaaaacaccacgtgacacacttttggccaaaa
ctcctgatgaaggtgacagatctgcggatgataggagcctgccatgccagccgcttcctg
cacatgaaggtggaatgccccacagaactcttcccccctttgttcttggaagtgttcgag
gattag

DBGET integrated database retrieval system