KEGG   Homo sapiens (human): 7074Help
Entry
7074              CDS       T01001                                 

Gene name
TIAM1
Definition
T-cell lymphoma invasion and metastasis 1
Orthology
K05731  
T-lymphoma invasion and metastasis-inducing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
Regulation of actin cytoskeleton
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    7074 (TIAM1)
   04015 Rap1 signaling pathway
    7074 (TIAM1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    7074 (TIAM1)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    7074 (TIAM1)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    7074 (TIAM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
21q22.11
AA seq 1591 aa AA seqDB search
MGNAESQHVEHEFYGEKHASLGRKHTSRSLRLSHKTRRTRHASSGKVIHRNSEVSTRSSS
TPSIPQSLAENGLEPFSQDGTLEDFGSPIWVDRVDMGLRPVSYTDSSVTPSVDSSIVLTA
ASVQSMPDTEESRLYGDDATYLAEGGRRQHSYTSNGPTFMETASFKKKRSKSADIWREDS
LEFSLSDLSQEHLTSNEEILGSAEEKDCEEARGMETRASPRQLSTCQRANSLGDLYAQKN
SGVTANGGPGSKFAGYCRNLVSDIPNLANHKMPPAAAEETPPYSNYNTLPCRKSHCLSEG
ATNPQISHSNSMQGRRAKTTQDVNAGEGSEFADSGIEGATTDTDLLSRRSNATNSSYSPT
TGRAFVGSDSGSSSTGDAARQGVYENFRRELEMSTTNSESLEEAGSAHSDEQSSGTLSSP
GQSDILLTAAQGTVRKAGALAVKNFLVHKKNKKVESATRRKWKHYWVSLKGCTLFFYESD
GRSGIDHNSIPKHAVWVENSIVQAVPEHPKKDFVFCLSNSLGDAFLFQTTSQTELENWIT
AIHSACATAVARHHHKEDTLRLLKSEIKKLEQKIDMDEKMKKMGEMQLSSVTDSKKKKTI
LDQIFVWEQNLEQFQMDLFRFRCYLASLQGGELPNPKRLLAFASRPTKVAMGRLGIFSVS
SFHALVAARTGETGVRRRTQAMSRSASKRRSRFSSLWGLDTTSKKKQGRPSINQVFGEGT
EAVKKSLEGIFDDIVPDGKREKEVVLPNVHQHNPDCDIWVHEYFTPSWFCLPNNQPALTV
VRPGDTARDTLELICKTHQLDHSAHYLRLKFLIENKMQLYVPQPEEDIYELLYKEIEICP
KVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINN
RAADALNSSMLKDFLSQPSLGLLVRTYPELEEGVELLESPPHRVDGPADLGESPLAFLTS
NPGHSLCSEQGSSAETAPEETEGPDLESSDETDHSSKSTEQVAAFCRSLHEMNPSDQSPS
PQDSTGPQLATMRQLSDADKLRKVICELLETERTYVKDLNCLMERYLKPLQKETFLTQDE
LDVLFGNLTEMVEFQVEFLKTLEDGVRLVPDLEKLEKVDQFKKVLFSLGGSFLYYADRFK
LYSAFCASHTKVPKVLVKAKTDTAFKAFLDAQNPKQQHSSTLESYLIKPIQRILKYPLLL
RELFALTDAESEEHYHLDVAIKTMNKVASHINEMQKIHEEFGAVFDQLIAEQTGEKKEVA
DLSMGDLLLHTTVIWLNPPASLGKWKKEPELAAFVFKTAVVLVYKDGSKQKKKLVGSHRL
SIYEDWDPFRFRHMIPTEALQVRALASADAEANAVCEIVHVKSESEGRPERVFHLCCSSP
ESRKDFLKAVHSILRDKHRRQLLKTESLPSSQQYVPFGGKRLCALKGARPAMSRAVSAPS
KSLGRRRRRLARNRFTIDSDAVSASSPEKESQQPPGGGDTDRWVEEQFDLAQYEEQDDIK
ETDILSDDDEFCESVKGASVDRDLQERLQATSISQRERGRKTLDSHASRMAQLKKQAALS
GINGGLESASEEVIWVRREDFAPSRKLNTEI
NT seq 4776 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacgcagaaagtcaacatgtagagcacgagttttatggagaaaagcatgccagc
ctggggcgcaagcacacttcccgctccctgcgcctctcgcacaagacgcggaggaccagg
cacgcttcctcggggaaggtgatccacaggaactccgaagtgagcacccgatccagcagc
acccccagcatcccccagtccctggctgaaaatggcctggagcccttctcccaagatggt
accctagaagacttcgggagccccatctgggtggaccgagtggacatgggcttgagacct
gtgtcttacactgactcttctgtcactcccagcgtagacagcagcatcgtcctcacagca
gcctctgtgcagagcatgccagacactgaggagagcaggctttacggggatgacgctaca
tatttggctgagggaggcaggaggcagcattcctatacatccaatgggcccactttcatg
gagacggcgagctttaagaagaaacgctccaaatctgcagacatctggcgggaggacagc
ctggaattctcactctctgatctgagccaagaacatttaacaagcaacgaagaaatcttg
ggttccgccgaagagaaggactgcgaggaggctcgggggatggaaacgcgggcgagtccg
cggcagctcagcacctgtcagagagccaattccttgggtgacttgtatgctcagaaaaac
tctggagtgacagcaaacggggggccggggagcaaatttgcaggctactgtcggaatttg
gtgtctgatattcccaatcttgcaaaccataagatgccaccagctgctgctgaagagact
cctccgtacagtaattataacacacttccctgtaggaaatctcactgtctctctgaaggt
gccaccaacccacaaattagccatagcaacagcatgcaaggcagaagagctaaaacaact
caggatgttaatgcaggcgagggcagtgagtttgcagacagtgggattgaaggggccact
accgacacggacctcctgtccaggcgatctaatgccaccaactccagctactcacccacc
acaggccgggcctttgtgggcagcgacagcggcagcagctccaccggggatgcggctcgt
cagggggtgtacgagaacttccggcgggagctggagatgagcaccaccaacagcgagagc
ctggaggaggccggctcggcgcacagcgatgagcagagcagcggcaccctgagctctccg
ggccagtcggacatcctgctgaccgccgcacagggcacggtgcgcaaggccggcgccctg
gccgtcaagaacttcctggtgcacaagaagaacaagaaggtggagtcagccacccggagg
aagtggaagcactactgggtgtccctgaaaggatgcacgctatttttctacgagagcgac
ggcaggtctgggatagaccacaacagcatccccaaacacgccgtctgggtggagaacagc
attgtgcaggcggtgcctgagcaccccaagaaggactttgtcttctgcctcagcaattcc
ctgggtgatgccttcctttttcagaccactagccagacggagcttgaaaactggatcacc
gccatccactctgcctgcgccactgcggtcgcgaggcaccaccacaaggaagacacgctc
cgactcctgaaatcagagatcaaaaaactggaacagaagattgacatggatgaaaagatg
aagaaaatgggtgaaatgcagctgtcttcagtcactgactcaaagaaaaagaaaacaata
ttagatcagatctttgtctgggagcaaaatctcgagcagttccaaatggacctgtttcgt
ttccgctgttatttagccagccttcagggtggggagctgccaaaccccaaaaggcttctc
gcttttgcaagtcgaccaacgaaagtggccatgggccgccttggaatcttttcggtatca
tcgtttcatgccctggtggcagcacgcactggtgaaactggagtgagaagacgtactcag
gccatgtccagatccgcgagcaagcgaaggagcaggttttcttctctgtggggtctggat
actacctccaaaaagaagcagggacggccaagcatcaatcaggtgtttggagagggaacc
gaagctgtaaagaaatctttagagggaatatttgatgacattgttccagatggcaagagg
gagaaagaagtggtcttacctaacgttcaccagcacaaccctgactgcgacatttgggtc
cacgagtatttcactccatcctggttctgtctgcccaataatcagcctgccctgacggtc
gtccggccaggcgacactgcacgggacaccctggagctgatttgcaagacacatcaactg
gatcattctgctcattacctgcgcctgaaatttctaatagaaaacaaaatgcagctctat
gttccacagcccgaggaagacatctatgagctgctgtacaaagaaattgaaatctgtcca
aaagtcactcagagcatccacattgagaagtcagatacagctgctgatacttacgggttt
tcactttcttctgtggaagaagatggtattcgaaggctgtacgtgaatagtgtgaaggaa
accggtttagcttccaagaaaggcctgaaagcaggagatgagattcttgagatcaataat
cgtgctgctgacgccctgaactcttctatgctcaaagatttcctctcacagccctcgctg
ggcctcctggtgaggacctaccccgagctggaggaaggagtggagctgctggaaagcccg
ccccaccgagtggacggccctgccgaccttggcgagagccccctcgcctttctcaccagc
aacccagggcacagcctttgcagcgagcagggcagcagtgctgagaccgctccagaggag
accgaggggccagacttggaatcctcagatgagactgatcacagcagcaagagtacagaa
caggtggccgcattttgccgcagtttgcatgagatgaacccctctgaccagagcccatct
cctcaggactccacggggcctcagctggcgaccatgagacaactctcggatgcagataag
ctgcgcaaggtgatctgcgagctcctggagacggagcgcacctacgtgaaggatttaaac
tgtcttatggagagatacctaaagcctcttcaaaaagaaacttttctcacccaggatgag
cttgacgtgctttttggaaatttaacggaaatggtagagtttcaagtagaattccttaaa
actctagaagatggagtgagactggtacctgatttggaaaagcttgagaaggttgatcaa
tttaagaaagtgctgttctctctggggggatcattcctgtattatgctgaccgcttcaag
ctctacagtgccttctgcgccagccacacaaaagttcccaaggtcctggtgaaagccaag
acagacacggctttcaaggcattcttggatgcccagaacccgaagcagcagcactcatcc
acgctggagtcgtacctcatcaagcccatccagaggatcctcaagtacccacttctgctc
agggagctgttcgccctgaccgatgcggagagcgaggagcactaccacctggacgtggcc
atcaagaccatgaacaaggttgccagtcacatcaatgagatgcagaaaatccatgaagag
tttggggctgtgtttgaccagctgattgctgaacagactggtgagaaaaaagaggttgca
gatctgagcatgggagacctgcttttgcacactaccgtgatctggctgaacccgccggcc
tcgctgggcaagtggaaaaaggaaccagagttggcagcattcgtcttcaaaactgctgtg
gtccttgtgtataaagatggttccaaacagaagaagaaacttgtaggatctcacaggctt
tccatttatgaggactgggaccccttcagatttcgacacatgatccccacggaagcgctg
caggttcgagctttggcgagtgcagatgcagaggcaaatgccgtgtgtgaaattgtccat
gtaaaatccgagtctgaagggaggccggagagggtctttcacttgtgctgcagctcccca
gagagccgaaaggatttcctaaaggctgtgcattcaatcctgcgtgataagcacagaaga
cagctcctcaaaaccgagagccttccctcatcccagcaatatgtcccttttggaggcaaa
agattgtgtgcactgaagggggccaggccggccatgagcagggcagtgtctgccccaagc
aagtctcttgggaggaggaggcggcggctggctcgaaacaggtttaccattgattctgat
gccgtctccgcaagcagcccggagaaagagtcccagcagccccccggtggtggggacact
gaccgatgggtagaggagcagtttgatcttgctcagtatgaggagcaagatgacatcaag
gagacagacatcctcagtgacgatgatgagttctgtgagtccgtgaagggtgcctcagtg
gacagagacctgcaggagcggcttcaggccacctccatcagtcagcgggaaagaggccgg
aaaaccctggatagtcacgcgtcccgcatggcacagctcaagaagcaagctgccctgtcg
gggatcaatggaggcctggagagcgcaagcgaggaagtcatttgggttaggcgtgaagac
tttgccccctccaggaaactgaacactgagatctga

  All links  
No link information was found.   
DBGET integrated database retrieval system