KEGG   Homo sapiens (human): 7075Help
Entry
7075              CDS       T01001                                 

Gene name
TIE1, JTK14, TIE
Definition
(RefSeq) tyrosine kinase with immunoglobulin like and EGF like domains 1 (EC:2.7.10.1)
  KO
K05120  
tyrosine kinase receptor 1 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     7075 (TIE1)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  Tie family
   7075 (TIE1)
Enzyme-linked receptors [BR:hsa01020]
 Receptor tyrosine kinases
  RTK class XI (TIE receptor family)
   7075 (TIE1)
Cytokine receptors [BR:hsa04050]
 Receptor tyrosine kinase
  RTK class XI (TIE receptor family)
   7075 (TIE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p34-p33
AA seq 1138 aa AA seqDB search
MVWRVPPFLLPILFLASHVGAAVDLTLLANLRLTDPQRFFLTCVSGEAGAGRGSDAWGPP
LLLEKDDRIVRTPPGPPLRLARNGSHQVTLRGFSKPSDLVGVFSCVGGAGARRTRVIYVH
NSPGAHLLPDKVTHTVNKGDTAVLSARVHKEKQTDVIWKSNGSYFYTLDWHEAQDGRFLL
QLPNVQPPSSGIYSATYLEASPLGSAFFRLIVRGCGAGRWGPGCTKECPGCLHGGVCHDH
DGECVCPPGFTGTRCEQACREGRFGQSCQEQCPGISGCRGLTFCLPDPYGCSCGSGWRGS
QCQEACAPGHFGADCRLQCQCQNGGTCDRFSGCVCPSGWHGVHCEKSDRIPQILNMASEL
EFNLETMPRINCAAAGNPFPVRGSIELRKPDGTVLLSTKAIVEPEKTTAEFEVPRLVLAD
SGFWECRVSTSGGQDSRRFKVNVKVPPVPLAAPRLLTKQSRQLVVSPLVSFSGDGPISTV
RLHYRPQDSTMDWSTIVVDPSENVTLMNLRPKTGYSVRVQLSRPGEGGEGAWGPPTLMTT
DCPEPLLQPWLEGWHVEGTDRLRVSWSLPLVPGPLVGDGFLLRLWDGTRGQERRENVSSP
QARTALLTGLTPGTHYQLDVQLYHCTLLGPASPPAHVLLPPSGPPAPRHLHAQALSDSEI
QLTWKHPEALPGPISKYVVEVQVAGGAGDPLWIDVDRPEETSTIIRGLNASTRYLFRMRA
SIQGLGDWSNTVEESTLGNGLQAEGPVQESRAAEEGLDQQLILAVVGSVSATCLTILAAL
LTLVCIRRSCLHRRRTFTYQSGSGEETILQFSSGTLTLTRRPKLQPEPLSYPVLEWEDIT
FEDLIGEGNFGQVIRAMIKKDGLKMNAAIKMLKEYASENDHRDFAGELEVLCKLGHHPNI
INLLGACKNRGYLYIAIEYAPYGNLLDFLRKSRVLETDPAFAREHGTASTLSSRQLLRFA
SDAANGMQYLSEKQFIHRDLAARNVLVGENLASKIADFGLSRGEEVYVKKTMGRLPVRWM
AIESLNYSVYTTKSDVWSFGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRMEQPRNCDD
EVYELMRQCWRDRPYERPPFAQIALQLGRMLEARKAYVNMSLFENFTYAGIDATAEEA
NT seq 3417 nt NT seq  +upstreamnt  +downstreamnt
atggtctggcgggtgccccctttcttgctccccatcctcttcttggcttctcatgtgggc
gcggcggtggacctgacgctgctggccaacctgcggctcacggacccccagcgcttcttc
ctgacttgcgtgtctggggaggccggggcggggaggggctcggacgcctggggcccgccc
ctgctgctggagaaggacgaccgtatcgtgcgcaccccgcccgggccacccctgcgcctg
gcgcgcaacggttcgcaccaggtcacgcttcgcggcttctccaagccctcggacctcgtg
ggcgtcttctcctgcgtgggcggtgctggggcgcggcgcacgcgcgtcatctacgtgcac
aacagccctggagcccacctgcttccagacaaggtcacacacactgtgaacaaaggtgac
accgctgtactttctgcacgtgtgcacaaggagaagcagacagacgtgatctggaagagc
aacggatcctacttctacaccctggactggcatgaagcccaggatgggcggttcctgctg
cagctcccaaatgtgcagccaccatcgagcggcatctacagtgccacttacctggaagcc
agccccctgggcagcgccttctttcggctcatcgtgcggggttgtggggctgggcgctgg
gggccaggctgtaccaaggagtgcccaggttgcctacatggaggtgtctgccacgaccat
gacggcgaatgtgtatgcccccctggcttcactggcacccgctgtgaacaggcctgcaga
gagggccgttttgggcagagctgccaggagcagtgcccaggcatatcaggctgccggggc
ctcaccttctgcctcccagacccctatggctgctcttgtggatctggctggagaggaagc
cagtgccaagaagcttgtgcccctggtcattttggggctgattgccgactccagtgccag
tgtcagaatggtggcacttgtgaccggttcagtggttgtgtctgcccctctgggtggcat
ggagtgcactgtgagaagtcagaccggatcccccagatcctcaacatggcctcagaactg
gagttcaacttagagacgatgccccggatcaactgtgcagctgcagggaaccccttcccc
gtgcggggcagcatagagctacgcaagccagacggcactgtgctcctgtccaccaaggcc
attgtggagccagagaagaccacagctgagttcgaggtgccccgcttggttcttgcggac
agtgggttctgggagtgccgtgtgtccacatctggcggccaagacagccggcgcttcaag
gtcaatgtgaaagtgccccccgtgcccctggctgcacctcggctcctgaccaagcagagc
cgccagcttgtggtctccccgctggtctcgttctctggggatggacccatctccactgtc
cgcctgcactaccggccccaggacagtaccatggactggtcgaccattgtggtggacccc
agtgagaacgtgacgttaatgaacctgaggccaaagacaggatacagtgttcgtgtgcag
ctgagccggccaggggaaggaggagagggggcctgggggcctcccaccctcatgaccaca
gactgtcctgagcctttgttgcagccgtggttggagggctggcatgtggaaggcactgac
cggctgcgagtgagctggtccttgcccttggtgcccgggccactggtgggcgacggtttc
ctgctgcgcctgtgggacgggacacgggggcaggagcggcgggagaacgtctcatccccc
caggcccgcactgccctcctgacgggactcacgcctggcacccactaccagctggatgtg
cagctctaccactgcaccctcctgggcccggcctcgccccctgcacacgtgcttctgccc
cccagtgggcctccagccccccgacacctccacgcccaggccctctcagactccgagatc
cagctgacatggaagcacccggaggctctgcctgggccaatatccaagtacgttgtggag
gtgcaggtggctgggggtgcaggagacccactgtggatagacgtggacaggcctgaggag
acaagcaccatcatccgtggcctcaacgccagcacgcgctacctcttccgcatgcgggcc
agcattcaggggctcggggactggagcaacacagtagaagagtccaccctgggcaacggg
ctgcaggctgagggcccagtccaagagagccgggcagctgaagagggcctggatcagcag
ctgatcctggcggtggtgggctccgtgtctgccacctgcctcaccatcctggctgccctt
ttaaccctggtgtgcatccgcagaagctgcctgcatcggagacgcaccttcacctaccag
tcaggctcgggcgaggagaccatcctgcagttcagctcagggaccttgacacttacccgg
cggccaaaactgcagcccgagcccctgagctacccagtgctagagtgggaggacatcacc
tttgaggacctcatcggggaggggaacttcggccaggtcatccgggccatgatcaagaag
gacgggctgaagatgaacgcagccatcaaaatgctgaaagagtatgcctctgaaaatgac
catcgtgactttgcgggagaactggaagttctgtgcaaattggggcatcaccccaacatc
atcaacctcctgggggcctgtaagaaccgaggttacttgtatatcgctattgaatatgcc
ccctacgggaacctgctagattttctgcggaaaagccgggtcctagagactgacccagct
tttgctcgagagcatgggacagcctctacccttagctcccggcagctgctgcgtttcgcc
agtgatgcggccaatggcatgcagtacctgagtgagaagcagttcatccacagggacctg
gctgcccggaatgtgctggtcggagagaacctagcctccaagattgcagacttcggcctt
tctcggggagaggaggtttatgtgaagaagacgatggggcgtctccctgtgcgctggatg
gccattgagtccctgaactacagtgtctataccaccaagagtgatgtctggtcctttgga
gtccttctttgggagatagtgagccttggaggtacaccctactgtggcatgacctgtgcc
gagctctatgaaaagctgccccagggctaccgcatggagcagcctcgaaactgtgacgat
gaagtgtacgagctgatgcgtcagtgctggcgggaccgtccctatgagcgaccccccttt
gcccagattgcgctacagctaggccgcatgctggaagccaggaaggcctatgtgaacatg
tcgctgtttgagaacttcacttacgcgggcattgatgccacagctgaggaggcctga

DBGET integrated database retrieval system