KEGG   Homo sapiens (human): 7076Help
Entry
7076              CDS       T01001                                 

Gene name
TIMP1, CLGI, EPA, EPO, HCI, TIMP
Definition
TIMP metallopeptidase inhibitor 1
Orthology
K16451  
metallopeptidase inhibitor 1
Organism
hsa  Homo sapiens (human)
Pathway
HIF-1 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    7076 (TIMP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp11.3-p11.23
AA seq 207 aa AA seqDB search
MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQR
YEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHIT
TCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEK
GFQSRHLACLPREPGLCTWQSLRSQIA
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggccccctttgagcccctggcttctggcatcctgttgttgctgtggctgatagccccc
agcagggcctgcacctgtgtcccaccccacccacagacggccttctgcaattccgacctc
gtcatcagggccaagttcgtggggacaccagaagtcaaccagaccaccttataccagcgt
tatgagatcaagatgaccaagatgtataaagggttccaagccttaggggatgccgctgac
atccggttcgtctacacccccgccatggagagtgtctgcggatacttccacaggtcccac
aaccgcagcgaggagtttctcattgctggaaaactgcaggatggactcttgcacatcact
acctgcagttttgtggctccctggaacagcctgagcttagctcagcgccggggcttcacc
aagacctacactgttggctgtgaggaatgcacagtgtttccctgtttatccatcccctgc
aaactgcagagtggcactcattgcttgtggacggaccagctcctccaaggctctgaaaag
ggcttccagtcccgtcaccttgcctgcctgcctcgggagccagggctgtgcacctggcag
tccctgcggtcccagatagcctga

DBGET integrated database retrieval system