KEGG   Homo sapiens (human): 708Help
Entry
708               CDS       T01001                                 

Gene name
C1QBP, GC1QBP, HABP1, SF2p32, gC1Q-R, gC1qR, p32
Definition
(RefSeq) complement C1q binding protein
  KO
K15414  
complement component 1 Q subcomponent-binding protein, mitochondrial
Organism
hsa  Homo sapiens (human)
Pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    708 (C1QBP)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   708 (C1QBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17p13.3
AA seq 282 aa AA seqDB search
MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLR
PRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKL
VRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKK
ALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLM
DFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgctgcctctgctgcgctgcgtgccccgtgtgctgggctcctccgtcgccggcctccgc
gctgccgcgcccgcctcgcctttccggcagctcctgcagccggcaccccggctgtgcacc
cggcccttcgggctgctcagcgtgcgcgcaggttccgagcggcggccgggcctcctgcgg
cctcgcggaccctgcgcctgtggctgtggctgcggctcgctgcacaccgacggagacaaa
gcttttgttgatttcctgagtgatgaaattaaggaggaaagaaaaattcagaagcataaa
accctccctaagatgtctggaggttgggagctggaactgaatgggacagaagcgaaatta
gtgcggaaagttgccggggaaaaaatcacggtcactttcaacattaacaacagcatccca
ccaacatttgatggtgaggaggaaccctcgcaagggcagaaggttgaagaacaggagcct
gaactgacatcaactcccaatttcgtggttgaagttataaagaatgatgatggcaagaag
gcccttgtgttggactgtcattatccagaggatgaggttggacaagaagacgaggctgag
agtgacatcttctctatcagggaagttagctttcagtccactggcgagtctgaatggaag
gatactaattatacactcaacacagattccttggactgggccttatatgaccacctaatg
gatttccttgccgaccgaggggtggacaacacttttgcagatgagctggtggagctcagc
acagccctggagcaccaggagtacattacttttcttgaagacctcaagagttttgtcaag
agccagtag

DBGET integrated database retrieval system