KEGG   Homo sapiens (human): 7083Help
Entry
7083              CDS       T01001                                 

Gene name
TK1, TK2
Definition
(RefSeq) thymidine kinase 1 (EC:2.7.1.21)
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
hsa  Homo sapiens (human)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    7083 (TK1)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    7083 (TK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     7083 (TK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q23.2-q25.3
AA seq 234 aa AA seqDB search
MSCINLPTVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTR
YSSSFCTHDRNTMEALPACLLRDVAQEALGVAVIGIDEGQFFPDIVEFCEAMANAGKTVI
VAALDGTFQRKPFGAILNLVPLAESVVKLTAVCMECFREAAYTKRLGTEKEVEVIGGADK
YHSVCRLCYFKKASGQPAGPDNKENCPVPGKPGEAVAARKLFAPQQILQCSPAN
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcattaacctgcccactgtgctgcctggctcccccagcaagacccgggggcag
atccaggtgattctcgggccgatgttctcaggaaaaagcacagagttgatgagacgcgtc
cgtcgcttccagattgctcagtacaagtgcctggtgatcaagtatgccaaagacactcgc
tacagcagcagcttctgcacacatgaccggaacaccatggaggcactgcccgcctgcctg
ctccgagacgtggcccaggaggccctgggcgtggctgtcataggcatcgacgaggggcag
tttttccctgacatcgtggagttctgcgaggccatggccaacgccgggaagaccgtaatt
gtggctgcactggatgggaccttccagaggaagccatttggggccatcctgaacctggtg
ccgctggccgagagcgtggtgaagctgacggcggtgtgcatggagtgcttccgggaagcc
gcctataccaagaggctcggcacagagaaggaggtcgaggtgattgggggagcagacaag
taccactccgtgtgtcggctctgctacttcaagaaggcctcaggccagcctgccgggccg
gacaacaaagagaactgcccagtgccaggaaagccaggggaagccgtggctgccaggaag
ctctttgccccacagcagattctgcaatgcagccctgccaactga

DBGET integrated database retrieval system