KEGG   Homo sapiens (human): 7084Help
Entry
7084              CDS       T01001                                 

Gene name
TK2, MTDPS2, MTTK
Definition
thymidine kinase 2, mitochondrial (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
hsa  Homo sapiens (human)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Disease
H00469  
Mitochondrial DNA depletion syndrome (MDS)
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:hsa00240]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:hsa00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
16q22-q23.1
AA seq 234 aa AA seqDB search
MGAFCQRPSSDKEQEKEKKSVICVEGNIASGKTTCLEFFSNATDVEVLTEPVSKWRNVRG
HNPLGLMYHDASRWGLTLQTYVQLTMLDRHTRPQVSSVRLMERSIHSARYIFVENLYRSG
KMPEVDYVVLSEWFDWILRNMDVSVDLIVYLRTNPETCYQRLKKRCREEEKVIPLEYLEA
IHHLHEEWLIKGSLFPMAAPVLVIEADHHMERMLELFEQNRDRILTPENRKHCP
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcgttctgccagcgtcctagcagtgataaagaacaggaaaaagagaaaaaatca
gtgatctgtgtcgagggcaatattgcaagtgggaagacgacatgcctggaattcttctcc
aacgcgacagacgtcgaggtgttaacggagcctgtgtccaagtggagaaatgtccgtggc
cacaatcctctgggcctgatgtaccacgatgcctctcgctggggtcttacgctacagact
tatgtgcagctcaccatgctggacaggcatactcgtcctcaggtgtcatctgtacggttg
atggagaggtcgattcacagcgcaagatacatttttgtagaaaacctgtatagaagtggg
aagatgccagaagtggactatgtagttctgtcggaatggtttgactggatcttgaggaac
atggacgtgtctgttgatttgatagtttaccttcggaccaatcctgagacttgttaccag
aggttaaagaagagatgcagggaagaggagaaggtcattccgctggaatacctggaagca
attcaccatctccatgaggagtggctcatcaaaggcagccttttccccatggcagcccct
gttctggtgattgaggctgaccaccacatggagaggatgttagaactctttgaacaaaat
cgggatcgaatattaactccagagaatcggaagcattgcccatag

DBGET integrated database retrieval system