KEGG   Homo sapiens (human): 7084Help
Entry
7084              CDS       T01001                                 

Gene name
TK2, MTDPS2, MTTK, PEOB3, SCA31
Definition
(RefSeq) thymidine kinase 2, mitochondrial
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00240  Pyrimidine metabolism
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
Disease
H00469  Mitochondrial DNA depletion syndrome (MDS)
H01118  Progressive external ophthalmoplegia (PEO)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    7084 (TK2)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    7084 (TK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     7084 (TK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: dNK AAA_33 AAA_18 Thymidylate_kin AAA_17 AAA_22 CoaE
Motif
Other DBs
NCBI-GeneID: 7084
NCBI-ProteinID: NP_004605
OMIM: 188250
HGNC: 11831
Ensembl: ENSG00000166548
Vega: OTTHUMG00000137499
Pharos: O00142(Tchem)
UniProt: O00142 Q8IZR3
Position
16q21
AA seq 265 aa AA seqDB search
MLLWPLRGWAARALRCFGPGSRGSPASGPGPRRVQRRAWPPDKEQEKEKKSVICVEGNIA
SGKTTCLEFFSNATDVEVLTEPVSKWRNVRGHNPLGLMYHDASRWGLTLQTYVQLTMLDR
HTRPQVSSVRLMERSIHSARYIFVENLYRSGKMPEVDYVVLSEWFDWILRNMDVSVDLIV
YLRTNPETCYQRLKKRCREEEKVIPLEYLEAIHHLHEEWLIKGSLFPMAAPVLVIEADHH
MERMLELFEQNRDRILTPENRKHCP
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgtggccgctgcggggctgggccgcccgggcgctgcgctgctttgggccggga
agtcgcgggagcccggcctcaggccccgggccgcggagggtgcagcgccgggcctggcct
cccgataaagaacaggaaaaagagaaaaaatcagtgatctgtgtcgagggcaatattgca
agtgggaagacgacatgcctggaattcttctccaacgcgacagacgtcgaggtgttaacg
gagcctgtgtccaagtggagaaatgtccgtggccacaatcctctgggcctgatgtaccac
gatgcctctcgctggggtcttacgctacagacttatgtgcagctcaccatgctggacagg
catactcgtcctcaggtgtcatctgtacggttgatggagaggtcgattcacagcgcaaga
tacatttttgtagaaaacctgtatagaagtgggaagatgccagaagtggactatgtagtt
ctgtcggaatggtttgactggatcttgaggaacatggacgtgtctgttgatttgatagtt
taccttcggaccaatcctgagacttgttaccagaggttaaagaagagatgcagggaagag
gagaaggtcattccgctggaatacctggaagcaattcaccatctccatgaggagtggctc
atcaaaggcagccttttccccatggcagcccctgttctggtgattgaggctgaccaccac
atggagaggatgttagaactctttgaacaaaatcgggatcgaatattaactccagagaat
cggaagcattgcccatag

DBGET integrated database retrieval system