KEGG   Homo sapiens (human): 7087Help
Entry
7087              CDS       T01001                                 

Gene name
ICAM5, TLCN, TLN
Definition
(RefSeq) intercellular adhesion molecule 5
  KO
K06769  intercellular adhesion molecule 5
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_2 Ig_3 I-set ig ICAM_N V-set C2-set_2
Motif
Other DBs
NCBI-GeneID: 7087
NCBI-ProteinID: NP_003250
OMIM: 601852
HGNC: 5348
Ensembl: ENSG00000105376
Vega: OTTHUMG00000180406
Pharos: Q9UMF0(Tbio)
UniProt: Q9UMF0 Q8N6I2
Structure
PDB: 

Jmol
Position
19p13.2
AA seq 924 aa AA seqDB search
MPGPSPGLRRALLGLWAALGLGLFGLSAVSQEPFWADLQPRVAFVERGGSLWLNCSTNCP
RPERGGLETSLRRNGTQRGLRWLARQLVDIREPETQPVCFFRCARRTLQARGLIRTFQRP
DRVELMPLPPWQPVGENFTLSCRVPGAGPRASLTLTLLRGAQELIRRSFAGEPPRARGAV
LTATVLARREDHGANFSCRAELDLRPHGLGLFENSSAPRELRTFSLSPDAPRLAAPRLLE
VGSERPVSCTLDGLFPASEARVYLALGDQNLSPDVTLEGDAFVATATATASAEQEGARQL
VCNVTLGGENRETRENVTIYSFPAPLLTLSEPSVSEGQMVTVTCAAGAQALVTLEGVPAA
VPGQPAQLQLNATENDDRRSFFCDATLDVDGETLIKNRSAELRVLYAPRLDDSDCPRSWT
WPEGPEQTLRCEARGNPEPSVHCARSDGGAVLALGLLGPVTRALSGTYRCKAANDQGEAV
KDVTLTVEYAPALDSVGCPERITWLEGTEASLSCVAHGVPPPDVICVRSGELGAVIEGLL
RVAREHAGTYRCEATNPRGSAAKNVAVTVEYGPRFEEPSCPSNWTWVEGSGRLFSCEVDG
KPQPSVKCVGSGGATEGVLLPLAPPDPSPRAPRIPRVLAPGIYVCNATNRHGSVAKTVVV
SAESPPEMDESTCPSHQTWLEGAEASALACAARGRPSPGVRCSREGIPWPEQQRVSREDA
GTYHCVATNAHGTDSRTVTVGVEYRPVVAELAASPPGGVRPGGNFTLTCRAEAWPPAQIS
WRAPPGALNIGLSSNNSTLSVAGAMGSHGGEYECAATNAHGRHARRITVRVAGPWLWVAV
GGAAGGAALLAAGAGLAFYVQSTACKKGEYNVQEAESSGEAVCLNGAGGGAGGAAGAEGG
PEAAGGAAESPAEGEVFAIQLTSA
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atgccagggccttcgccagggctgcgccgggcgctactcggcctctgggctgctctgggc
ctggggctcttcggcctctcagcggtctcgcaggagcccttctgggcggacctgcagcct
cgcgtggcgttcgtggagcgcgggggctcgctgtggctgaattgcagcaccaactgccct
cggccggagcgcggtggcctggagacctcgctgcgccgaaacgggacccagaggggtttg
cgttggttggcgcggcagctggtggacattcgcgagccggagactcagcccgtctgcttc
ttccgctgcgcgcggcgcacactacaggcgcgtgggctcattcgcactttccagcgacca
gatcgcgtagagctgatgccgctgcctccctggcagccggtgggcgagaacttcaccctg
agctgtagggtccccggcgccgggccccgtgcgagcctcacgctgaccctgctgcggggc
gcccaggagctgatccgccgcagcttcgccggtgaaccaccccgagcgcggggcgcggtg
ctcacagccacggtactggctcggagggaggaccatggagccaatttctcgtgtcgcgcc
gagctggacctgcggccgcacggactgggactgtttgaaaacagctcggcccccagagag
ctccgaaccttctccctgtctccggatgccccgcgcctcgctgctccccggctcttggaa
gttggctcggaaaggcccgtgagctgcactctggacggactgtttccagcctcagaggcc
agggtctacctcgcactgggggaccagaatctgagtcctgatgtcaccctcgaaggggac
gcattcgtggccactgccacagccacagctagcgcagagcaggagggtgccaggcagctg
gtctgcaacgtcaccctggggggcgaaaaccgggagacccgggagaacgtgaccatctac
agcttcccggcaccactcctgaccctgagcgaacccagcgtctccgaggggcagatggtg
acagtaacctgcgcagctggggcccaagctctggtcacactggagggagttccagccgcg
gtcccggggcagcccgcccagcttcagctaaatgccaccgagaacgacgacagacgcagc
ttcttctgcgacgccaccctcgatgtggacggggagaccctgatcaagaacaggagcgca
gagcttcgtgtcctatacgctccccggctagacgattcggactgccccaggagttggacg
tggcccgagggcccagagcagacgctgcgctgcgaggcccgcgggaacccagaaccctca
gtgcactgtgcgcgctccgacggcggggccgtgctggctctgggcctgctgggtccagtc
actcgggcgctctcaggcacttaccgctgcaaggcggccaatgatcaaggcgaggcggtc
aaggacgtaacgctaacggtggagtacgcaccagcgctggacagcgtgggctgcccagaa
cgcattacttggctggagggaacagaagcctcgctgagctgtgtggcgcacggggtaccg
ccgcctgatgtgatctgcgtgcgctctggagaactcggggccgtcatcgaggggctgttg
cgtgtggcccgggagcatgcgggcacttaccgctgcgaagccaccaaccctcggggctct
gcggccaaaaatgtggccgtcacggtggaatatggccccaggtttgaggagccgagctgc
cccagcaattggacatgggtggaaggatctgggcgcctgttttcctgtgaggtcgatggg
aagccacagccaagcgtgaagtgcgtgggctccgggggcgccactgagggggtgctgctg
ccgctggcacccccagaccctagtcccagagctcccagaatccctagagtcctggcaccc
ggtatctacgtctgcaacgccaccaaccgccacggctccgtggccaaaacagtcgtcgtg
agcgcggagtcgccaccggagatggatgaatctacctgcccaagtcaccagacgtggctg
gaaggggctgaggcttccgcgctggcctgcgccgcccggggtcgcccttccccaggagtg
cgctgctctcgggaaggcatcccatggcctgagcagcagcgcgtgtcccgagaggacgcg
ggcacttaccactgtgtggccaccaatgcgcatggcacggactcccggaccgtcactgtg
ggcgtggaataccggccagtggtggccgaacttgctgcctcgccccctggaggcgtgcgc
ccaggaggaaacttcacgttgacctgccgcgcggaggcctggcctccagcccagatcagc
tggcgcgcgcccccgggggccctcaacatcggcctgtcgagcaacaacagcacactgagc
gtggcaggcgccatgggaagccacggcggcgagtacgagtgcgcagccaccaacgcgcac
gggcgccacgcgcggcgcatcacggtgcgcgtggccggtccgtggctatgggtcgccgtg
ggcggcgcggcggggggcgcggcgctgctggccgcgggggccggcctggccttctacgtg
cagtccaccgcctgcaagaagggcgagtacaacgtgcaggaggccgagagctcaggcgag
gccgtgtgtctgaacggagcgggcggcggcgctggcggggcggcaggcgcggagggcgga
cccgaggcggcggggggcgcggccgagtcgccggcggagggcgaggtcttcgccatacag
ctgacatcggcgtga

DBGET integrated database retrieval system