KEGG   Homo sapiens (human): 7091Help
Entry
7091              CDS       T01001                                 

Gene name
TLE4, BCE-1, BCE1, E(spI), ESG, ESG4, GRG4, Grg-4
Definition
(RefSeq) transducin like enhancer of split 4
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
9q21.31
AA seq 773 aa AA seqDB search
MIRDLSKMYPQTRHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYHSLKLECEKLASEK
TEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNAICAQVIPFLSQEHQQQVVQAVERAKQV
TMAELNAIIGQQLQAQHLSHGHGLPVPLTPHPSGLQPPAIPPIGSSAGLLALSSALGGQS
HLPIKDEKKHHDNDHQRDRDSIKSSSVSPSASFRGAEKHRNSADYSSESKKQKTEEKEIA
ARYDSDGEKSDDNLVVDVSNEDPSSPRGSPAHSPRENGLDKTRLLKKDAPISPASIASSS
STPSSKSKELSLNEKSTTPVSKSNTPTPRTDAPTPGSNSTPGLRPVPGKPPGVDPLASSL
RTPMAVPCPYPTPFGIVPHAGMNGELTSPGAAYAGLHNISPQMSAAAAAAAAAAAYGRSP
VVGFDPHHHMRVPAIPPNLTGIPGGKPAYSFHVSADGQMQPVPFPPDALIGPGIPRHARQ
INTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCR
LLPDGRTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGN
IAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFT
SQIFSLGYCPTGEWLAVGMENSNVEVLHVTKPDKYQLHLHESCVLSLKFAHCGKWFVSTG
KDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgattcgcgacctgagcaagatgtacccgcagaccagacacccggcaccgcatcagcct
gctcaaccctttaaatttacaatttccgaatcctgtgatcggattaaggaagagtttcag
tttttacaggctcaataccacagtctgaagctggaatgtgagaaactcgccagtgagaag
acagagatgcagcggcattatgtcatgtattatgaaatgtcctatgggttgaatatagaa
atgcacaagcaggcagagattgtcaagaggctgaatgctatctgtgcacaagtcattcct
ttcctgtcccaagagcaccagcaacaagtggtgcaggctgtggaacgggccaagcaggtg
accatggcagaactgaacgccatcattgggcaacaactccaggcccagcatttatcacat
ggacatggtctccccgtacctctgactccacacccttcagggctccagccccctgccatt
ccacccatcggtagcagtgccgggcttctggccctctccagtgctctaggaggtcagtcc
catcttccaattaaagatgagaagaagcaccatgacaatgatcaccaaagagacagagac
tccatcaagagctcttcagtatccccatcagccagtttccgaggtgctgagaagcacaga
aactccgcagactactcctcagagagcaaaaagcagaaaactgaagaaaaggaaattgca
gctcgttatgacagcgatggtgagaaaagtgatgacaacttggtggttgacgtttccaat
gaggatccatcttcccctcgagggagcccagcacattcccccagagagaatggcctagac
aagacacgcctgctcaagaaagatgccccgattagtccagcctctattgcatcttccagc
agtactccctcctccaaatccaaagaacttagccttaatgaaaaatctactactcccgtc
tcaaagtccaatacccctactccacgaactgatgcgcccaccccaggcagtaactctact
cccggattgaggcctgtacctggaaaaccaccaggagttgaccctttggcctcaagccta
aggaccccaatggcagtaccttgtccatatccaactccatttgggattgtgccccatgct
ggaatgaacggagagctgaccagccccggagcggcctacgctgggctccacaacatctcc
cctcagatgagcgcagctgctgccgccgccgctgctgctgctgcctatgggagatcacca
gtggtgggatttgatccacaccatcacatgcgtgtgccagcaatacctccaaacctgaca
ggcattccaggaggaaaaccagcatactccttccatgttagcgcagatggtcagatgcag
cctgtcccttttccacccgacgccctcatcggacctggaatcccccggcatgctcgccag
atcaacaccctcaaccacggggaggtggtgtgcgcggtgaccatcagcaaccccacgaga
cacgtgtacacgggtgggaagggctgcgtcaaggtctgggacatcagccacccaggcaat
aagagtcctgtctcccagctcgactgtctgaacagggataactacatccgttcctgcaga
ttgctccctgatggtcgcaccctaattgttggaggggaagccagtactttgtccatttgg
gacctggcggctccaaccccacgcatcaaggcagagctgacatcctcggcccccgcctgc
tatgccctggccatcagccccgattccaaggtctgcttctcatgctgcagcgacggcaac
atcgctgtgtgggatctgcacaaccagaccttggtgaggcaattccagggccacacagat
ggagccagctgtattgacatttctaatgatggcaccaagctctggacaggtggtttggac
aacacggtcaggtcctgggacctgcgcgaggggcggcagctgcagcagcacgacttcacc
tcccagatcttttctctgggctactgcccaactggagagtggcttgcagtggggatggag
aacagcaatgtggaagttttgcatgtcaccaagccagacaaataccaactacatcttcat
gagagctgtgtgctgtcgctcaagtttgcccattgtggcaaatggtttgtaagcactgga
aaggacaaccttctgaatgcctggagaacaccttatggggccagtatattccagtccaaa
gaatcctcatcggtgcttagctgtgacatctccgtggacgacaaatacattgtcactggc
tctggggataagaaggccacagtttatgaagttatttattaa

DBGET integrated database retrieval system