KEGG   Homo sapiens (human): 7095Help
Entry
7095              CDS       T01001                                 

Gene name
SEC62, Dtrp1, HTP1, TLOC1, TP-1
Definition
(RefSeq) SEC62 homolog, preprotein translocation factor
  KO
K12275  translocation protein SEC62
Organism
hsa  Homo sapiens (human)
Pathway
hsa03060  Protein export
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    7095 (SEC62)
   04141 Protein processing in endoplasmic reticulum
    7095 (SEC62)
Secretion system [BR:hsa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   7095 (SEC62)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec62 DEP
Motif
Other DBs
NCBI-GeneID: 7095
NCBI-ProteinID: NP_003253
OMIM: 602173
HGNC: 11846
Ensembl: ENSG00000008952
Vega: OTTHUMG00000158753
Pharos: Q99442(Tbio)
UniProt: Q99442
Position
3q26.2
AA seq 399 aa AA seqDB search
MAERRRHKKRIQEVGEPSKEEKAVAKYLRFNCPTKSTNMMGHRVDYFIASKAVDCLLDSK
WAKAKKGEEALFTTRESVVDYCNRLLKKQFFHRALKVMKMKYDKDIKKEKDKGKAESGKE
EDKKSKKENIKDEKTKKEKEKKKDGEKEESKKEETPGTPKKKETKKKFKLEPHDDQVFLD
GNEVYVWIYDPVHFKTFVMGLILVIAVIAATLFPLWPAEMRVGVYYLSVGAGCFVASILL
LAVARCILFLIIWLITGGRHHFWFLPNLTADVGFIDSFRPLYTHEYKGPKADLKKDEKSE
TKKQQKSDSEEKSDSEKKEDEEGKVGPGNHGTEGSGGERHSDTDSDRREDDRSQHSSGNG
NDFEMITKEELEQQTDGDCEEDEEEENDGETPKSSHEKS
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcggaacgcaggagacacaagaagcggatccaggaagttggtgaaccatctaaagaa
gagaaggctgtggccaagtatcttcgattcaactgtccaacaaagtccaccaatatgatg
ggtcaccgggttgattattttattgcttcaaaagcagtggactgtcttttggattcaaag
tgggcaaaggccaagaaaggagaggaagctttatttacaaccagggagtctgtggttgac
tactgcaacaggcttttaaagaagcagttttttcaccgagccctaaaagtaatgaaaatg
aaatatgataaagacataaagaaagaaaaagataaaggaaaagctgaaagtggaaaagaa
gaagataaaaagagcaagaaagaaaatataaaggatgagaagacaaaaaaagaaaaagag
aaaaaaaaagatggtgaaaaggaagaatccaaaaaggaggaaactccaggaactcctaaa
aagaaggaaactaagaaaaaattcaaacttgagccacatgatgatcaggtttttctggat
ggaaatgaggtgtatgtatggatctatgacccagttcactttaaaacatttgtcatggga
ttaattcttgtgattgcagtaatagcggccaccctcttccccctttggccagcagaaatg
agagtaggtgtttattacctcagtgtgggtgcaggctgttttgtagccagtattcttctc
cttgctgttgctcgatgcattctatttctcatcatttggctcataactggaggaaggcac
cacttttggttcttgccaaatctgactgctgatgtgggcttcattgactccttcaggcct
ctgtacacacatgaatacaaaggaccaaaagcagacttaaagaaagatgagaagtctgaa
accaaaaagcaacagaagtccgacagtgaggaaaagtcagacagtgagaaaaaggaagat
gaggaggggaaagtaggaccaggaaatcatggaacagaaggctcggggggagaacggcat
tcagacacggacagtgacaggagggaagatgatcgatcccagcacagtagtggaaatgga
aatgattttgaaatgataacaaaagaggaactggaacagcaaacagatggggattgtgaa
gaggatgaggaagaggaaaatgatggagaaacacctaaatcttcacatgaaaaatcataa

DBGET integrated database retrieval system