KEGG   Homo sapiens (human): 7095Help
Entry
7095              CDS       T01001                                 

Gene name
SEC62, Dtrp1, HTP1, TLOC1, TP-1
Definition
SEC62 homolog (S. cerevisiae)
Orthology
K12275  
translocation protein SEC62
Organism
hsa  Homo sapiens (human)
Pathway
Protein export
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein export [PATH:hsa03060]
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:hsa04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q26.2
AA seq 399 aa AA seqDB search
MAERRRHKKRIQEVGEPSKEEKAVAKYLRFNCPTKSTNMMGHRVDYFIASKAVDCLLDSK
WAKAKKGEEALFTTRESVVDYCNRLLKKQFFHRALKVMKMKYDKDIKKEKDKGKAESGKE
EDKKSKKENIKDEKTKKEKEKKKDGEKEESKKEETPGTPKKKETKKKFKLEPHDDQVFLD
GNEVYVWIYDPVHFKTFVMGLILVIAVIAATLFPLWPAEMRVGVYYLSVGAGCFVASILL
LAVARCILFLIIWLITGGRHHFWFLPNLTADVGFIDSFRPLYTHEYKGPKADLKKDEKSE
TKKQQKSDSEEKSDSEKKEDEEGKVGPGNHGTEGSGGERHSDTDSDRREDDRSQHSSGNG
NDFEMITKEELEQQTDGDCEEDEEEENDGETPKSSHEKS
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcggaacgcaggagacacaagaagcggatccaggaagttggtgaaccatctaaagaa
gagaaggctgtggccaagtatcttcgattcaactgtccaacaaagtccaccaatatgatg
ggtcaccgggttgattattttattgcttcaaaagcagtggactgtcttttggattcaaag
tgggcaaaggccaagaaaggagaggaagctttatttacaaccagggagtctgtggttgac
tactgcaacaggcttttaaagaagcagttttttcaccgagccctaaaagtaatgaaaatg
aaatatgataaagacataaagaaagaaaaagataaaggaaaagctgaaagtggaaaagaa
gaagataaaaagagcaagaaagaaaatataaaggatgagaagacaaaaaaagaaaaagag
aaaaaaaaagatggtgaaaaggaagaatccaaaaaggaggaaactccaggaactcctaaa
aagaaggaaactaagaaaaaattcaaacttgagccacatgatgatcaggtttttctggat
ggaaatgaggtgtatgtatggatctatgacccagttcactttaaaacatttgtcatggga
ttaattcttgtgattgcagtaatagcggccaccctcttccccctttggccagcagaaatg
agagtaggtgtttattacctcagtgtgggtgcaggctgttttgtagccagtattcttctc
cttgctgttgctcgatgcattctatttctcatcatttggctcataactggaggaaggcac
cacttttggttcttgccaaatctgactgctgatgtgggcttcattgactccttcaggcct
ctgtacacacatgaatacaaaggaccaaaagcagacttaaagaaagatgagaagtctgaa
accaaaaagcaacagaagtccgacagtgaggaaaagtcagacagtgagaaaaaggaagat
gaggaggggaaagtaggaccaggaaatcatggaacagaaggctcggggggagaacggcat
tcagacacggacagtgacaggagggaagatgatcgatcccagcacagtagtggaaatgga
aatgattttgaaatgataacaaaagaggaactggaacagcaaacagatggggattgtgaa
gaggatgaggaagaggaaaatgatggagaaacacctaaatcttcacatgaaaaatcataa

DBGET integrated database retrieval system