KEGG   Homo sapiens (human): 7097Help
Entry
7097              CDS       T01001                                 

Gene name
TLR2, CD282, TIL4
Definition
(RefSeq) toll like receptor 2
  KO
K10159  toll-like receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04151  PI3K-Akt signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa05134  Legionellosis
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05144  Malaria
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05162  Measles
hsa05168  Herpes simplex infection
hsa05205  Proteoglycans in cancer
hsa05321  Inflammatory bowel disease (IBD)
hsa05323  Rheumatoid arthritis
Module
hsa_M00686  Toll-like receptor signaling
Disease
H00344  Leprosy
H01358  Atopic dermatitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    7097 (TLR2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    7097 (TLR2)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    7097 (TLR2)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    7097 (TLR2)
  Immune diseases
   05323 Rheumatoid arthritis
    7097 (TLR2)
   05321 Inflammatiory bowel disease (IBD)
    7097 (TLR2)
  Infectious diseases
   05134 Legionellosis
    7097 (TLR2)
   05152 Tuberculosis
    7097 (TLR2)
   05162 Measles
    7097 (TLR2)
   05161 Hepatitis B
    7097 (TLR2)
   05168 Herpes simplex infection
    7097 (TLR2)
   05146 Amoebiasis
    7097 (TLR2)
   05144 Malaria
    7097 (TLR2)
   05145 Toxoplasmosis
    7097 (TLR2)
   05140 Leishmaniasis
    7097 (TLR2)
   05142 Chagas disease (American trypanosomiasis)
    7097 (TLR2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    7097 (TLR2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   7097 (TLR2)
Pattern recognition receptors [BR:hsa04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   7097 (TLR2)
CD molecules [BR:hsa04090]
 Proteins
  7097 (TLR2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Hyaluronan
  Cell surface receptors
   7097 (TLR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 TIR LRR_4 TIR_2 LRR_9 LRR_5 LRR_1 LRRCT DUF1863
Motif
Other DBs
NCBI-GeneID: 7097
NCBI-ProteinID: NP_001305716
OMIM: 603028
HGNC: 11848
Ensembl: ENSG00000137462
Vega: OTTHUMG00000161525
Pharos: O60603(Tchem)
UniProt: O60603 B3KWR9 A0A0S2Z4S4
Structure
PDB: 

Jmol
Position
4q31.3
AA seq 784 aa AA seqDB search
MPHTLWMVWVLGVIISLSKEESSNQASLSCDRNGICKGSSGSLNSIPSGLTEAVKSLDLS
NNRITYISNSDLQRCVNLQALVLTSNGINTIEEDSFSSLGSLEHLDLSYNYLSNLSSSWF
KPLSSLTFLNLLGNPYKTLGETSLFSHLTKLQILRVGNMDTFTKIQRKDFAGLTFLEELE
IDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFVDVTSSVECLELRDTDLDTFHFS
ELSTGETNSLIKKFTFRNVKITDESLFQVMKLLNQISGLLELEFDDCTLNGVGNFRASDN
DRVIDPGKVETLTIRRLHIPRFYLFYDLSTLYSLTERVKRITVENSKVFLVPCLLSQHLK
SLEYLDLSENLMVEEYLKNSACEDAWPSLQTLILRQNHLASLEKTGETLLTLKNLTNIDI
SKNSFHSMPETCQWPEKMKYLNLSSTRIHSVTGCIPKTLEILDVSNNNLNLFSLNLPQLK
ELYISRNKLMTLPDASLLPMLLVLKISRNAITTFSKEQLDSFHTLKTLEAGGNNFICSCE
FLSFTQEQQALAKVLIDWPANYLCDSPSHVRGQQVQDVRLSVSECHRTALVSGMCCALFL
LILLTGVLCHRFHGLWYMKMMWAWLQAKRKPRKAPSRNICYDAFVSYSERDAYWVENLMV
QELENFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTVFVLSENFVKSEWCKYELDFS
HFRLFDENNDAAILILLEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRA
AIKS
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgccacatactttgtggatggtgtgggtcttgggggtcatcatcagcctctccaaggaa
gaatcctccaatcaggcttctctgtcttgtgaccgcaatggtatctgcaagggcagctca
ggatctttaaactccattccctcagggctcacagaagctgtaaaaagccttgacctgtcc
aacaacaggatcacctacattagcaacagtgacctacagaggtgtgtgaacctccaggct
ctggtgctgacatccaatggaattaacacaatagaggaagattctttttcttccctgggc
agtcttgaacatttagacttatcctataattacttatctaatttatcgtcttcctggttc
aagcccctttcttctttaacattcttaaacttactgggaaatccttacaaaaccctaggg
gaaacatctcttttttctcatctcacaaaattgcaaatcctgagagtgggaaatatggac
accttcactaagattcaaagaaaagattttgctggacttaccttccttgaggaacttgag
attgatgcttcagatctacagagctatgagccaaaaagtttgaagtcaattcagaatgta
agtcatctgatccttcatatgaagcagcatattttactgctggagatttttgtagatgtt
acaagttccgtggaatgtttggaactgcgagatactgatttggacactttccatttttca
gaactatccactggtgaaacaaattcattgattaaaaagtttacatttagaaatgtgaaa
atcaccgatgaaagtttgtttcaggttatgaaacttttgaatcagatttctggattgtta
gaattagagtttgatgactgtacccttaatggagttggtaattttagagcatctgataat
gacagagttatagatccaggtaaagtggaaacgttaacaatccggaggctgcatattcca
aggttttacttattttatgatctgagcactttatattcacttacagaaagagttaaaaga
atcacagtagaaaacagtaaagtttttctggttccttgtttactttcacaacatttaaaa
tcattagaatacttggatctcagtgaaaatttgatggttgaagaatacttgaaaaattca
gcctgtgaggatgcctggccctctctacaaactttaattttaaggcaaaatcatttggca
tcattggaaaaaaccggagagactttgctcactctgaaaaacttgactaacattgatatc
agtaagaatagttttcattctatgcctgaaacttgtcagtggccagaaaagatgaaatat
ttgaacttatccagcacacgaatacacagtgtaacaggctgcattcccaagacactggaa
attttagatgttagcaacaacaatctcaatttattttctttgaatttgccgcaactcaaa
gaactttatatttccagaaataagttgatgactctaccagatgcctccctcttacccatg
ttactagtattgaaaatcagtaggaatgcaataactacgttttctaaggagcaacttgac
tcatttcacacactgaagactttggaagctggtggcaataacttcatttgctcctgtgaa
ttcctctccttcactcaggagcagcaagcactggccaaagtcttgattgattggccagca
aattacctgtgtgactctccatcccatgtgcgtggccagcaggttcaggatgtccgcctc
tcggtgtcggaatgtcacaggacagcactggtgtctggcatgtgctgtgctctgttcctg
ctgatcctgctcacgggggtcctgtgccaccgtttccatggcctgtggtatatgaaaatg
atgtgggcctggctccaggccaaaaggaagcccaggaaagctcccagcaggaacatctgc
tatgatgcatttgtttcttacagtgagcgggatgcctactgggtggagaaccttatggtc
caggagctggagaacttcaatccccccttcaagttgtgtcttcataagcgggacttcatt
cctggcaagtggatcattgacaatatcattgactccattgaaaagagccacaaaactgtc
tttgtgctttctgaaaactttgtgaagagtgagtggtgcaagtatgaactggacttctcc
catttccgtctttttgatgagaacaatgatgctgccattctcattcttctggagcccatt
gagaaaaaagccattccccagcgcttctgcaagctgcggaagataatgaacaccaagacc
tacctggagtggcccatggacgaggctcagcgggaaggattttgggtaaatctgagagct
gcgataaagtcctag

DBGET integrated database retrieval system