KEGG   Homo sapiens (human): 7097Help
Entry
7097              CDS       T01001                                 

Gene name
TLR2, CD282, TIL4
Definition
(RefSeq) toll like receptor 2
  KO
K10159  
toll-like receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
PI3K-Akt signaling pathway
Toll-like receptor signaling pathway
Legionellosis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Malaria
Toxoplasmosis
Amoebiasis
Tuberculosis
Hepatitis B
Measles
Herpes simplex infection
Proteoglycans in cancer
Inflammatory bowel disease (IBD)
Rheumatoid arthritis
Module
Toll-like receptor signaling
Disease
H00344  
Leprosy
H01358  
Atopic dermatitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    7097 (TLR2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    7097 (TLR2)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    7097 (TLR2)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    7097 (TLR2)
  Immune diseases
   05323 Rheumatoid arthritis
    7097 (TLR2)
   05321 Inflammatiory bowel disease (IBD)
    7097 (TLR2)
  Infectious diseases
   05134 Legionellosis
    7097 (TLR2)
   05152 Tuberculosis
    7097 (TLR2)
   05162 Measles
    7097 (TLR2)
   05161 Hepatitis B
    7097 (TLR2)
   05168 Herpes simplex infection
    7097 (TLR2)
   05146 Amoebiasis
    7097 (TLR2)
   05144 Malaria
    7097 (TLR2)
   05145 Toxoplasmosis
    7097 (TLR2)
   05140 Leishmaniasis
    7097 (TLR2)
   05142 Chagas disease (American trypanosomiasis)
    7097 (TLR2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   7097 (TLR2)
Cellular antigens [BR:hsa04090]
 Proteins
  7097 (TLR2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Hyaluronan
  Cell surface receptors
   7097 (TLR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q32
AA seq 784 aa AA seqDB search
MPHTLWMVWVLGVIISLSKEESSNQASLSCDRNGICKGSSGSLNSIPSGLTEAVKSLDLS
NNRITYISNSDLQRCVNLQALVLTSNGINTIEEDSFSSLGSLEHLDLSYNYLSNLSSSWF
KPLSSLTFLNLLGNPYKTLGETSLFSHLTKLQILRVGNMDTFTKIQRKDFAGLTFLEELE
IDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFVDVTSSVECLELRDTDLDTFHFS
ELSTGETNSLIKKFTFRNVKITDESLFQVMKLLNQISGLLELEFDDCTLNGVGNFRASDN
DRVIDPGKVETLTIRRLHIPRFYLFYDLSTLYSLTERVKRITVENSKVFLVPCLLSQHLK
SLEYLDLSENLMVEEYLKNSACEDAWPSLQTLILRQNHLASLEKTGETLLTLKNLTNIDI
SKNSFHSMPETCQWPEKMKYLNLSSTRIHSVTGCIPKTLEILDVSNNNLNLFSLNLPQLK
ELYISRNKLMTLPDASLLPMLLVLKISRNAITTFSKEQLDSFHTLKTLEAGGNNFICSCE
FLSFTQEQQALAKVLIDWPANYLCDSPSHVRGQQVQDVRLSVSECHRTALVSGMCCALFL
LILLTGVLCHRFHGLWYMKMMWAWLQAKRKPRKAPSRNICYDAFVSYSERDAYWVENLMV
QELENFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTVFVLSENFVKSEWCKYELDFS
HFRLFDENNDAAILILLEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRA
AIKS
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgccacatactttgtggatggtgtgggtcttgggggtcatcatcagcctctccaaggaa
gaatcctccaatcaggcttctctgtcttgtgaccgcaatggtatctgcaagggcagctca
ggatctttaaactccattccctcagggctcacagaagctgtaaaaagccttgacctgtcc
aacaacaggatcacctacattagcaacagtgacctacagaggtgtgtgaacctccaggct
ctggtgctgacatccaatggaattaacacaatagaggaagattctttttcttccctgggc
agtcttgaacatttagacttatcctataattacttatctaatttatcgtcttcctggttc
aagcccctttcttctttaacattcttaaacttactgggaaatccttacaaaaccctaggg
gaaacatctcttttttctcatctcacaaaattgcaaatcctgagagtgggaaatatggac
accttcactaagattcaaagaaaagattttgctggacttaccttccttgaggaacttgag
attgatgcttcagatctacagagctatgagccaaaaagtttgaagtcaattcagaatgta
agtcatctgatccttcatatgaagcagcatattttactgctggagatttttgtagatgtt
acaagttccgtggaatgtttggaactgcgagatactgatttggacactttccatttttca
gaactatccactggtgaaacaaattcattgattaaaaagtttacatttagaaatgtgaaa
atcaccgatgaaagtttgtttcaggttatgaaacttttgaatcagatttctggattgtta
gaattagagtttgatgactgtacccttaatggagttggtaattttagagcatctgataat
gacagagttatagatccaggtaaagtggaaacgttaacaatccggaggctgcatattcca
aggttttacttattttatgatctgagcactttatattcacttacagaaagagttaaaaga
atcacagtagaaaacagtaaagtttttctggttccttgtttactttcacaacatttaaaa
tcattagaatacttggatctcagtgaaaatttgatggttgaagaatacttgaaaaattca
gcctgtgaggatgcctggccctctctacaaactttaattttaaggcaaaatcatttggca
tcattggaaaaaaccggagagactttgctcactctgaaaaacttgactaacattgatatc
agtaagaatagttttcattctatgcctgaaacttgtcagtggccagaaaagatgaaatat
ttgaacttatccagcacacgaatacacagtgtaacaggctgcattcccaagacactggaa
attttagatgttagcaacaacaatctcaatttattttctttgaatttgccgcaactcaaa
gaactttatatttccagaaataagttgatgactctaccagatgcctccctcttacccatg
ttactagtattgaaaatcagtaggaatgcaataactacgttttctaaggagcaacttgac
tcatttcacacactgaagactttggaagctggtggcaataacttcatttgctcctgtgaa
ttcctctccttcactcaggagcagcaagcactggccaaagtcttgattgattggccagca
aattacctgtgtgactctccatcccatgtgcgtggccagcaggttcaggatgtccgcctc
tcggtgtcggaatgtcacaggacagcactggtgtctggcatgtgctgtgctctgttcctg
ctgatcctgctcacgggggtcctgtgccaccgtttccatggcctgtggtatatgaaaatg
atgtgggcctggctccaggccaaaaggaagcccaggaaagctcccagcaggaacatctgc
tatgatgcatttgtttcttacagtgagcgggatgcctactgggtggagaaccttatggtc
caggagctggagaacttcaatccccccttcaagttgtgtcttcataagcgggacttcatt
cctggcaagtggatcattgacaatatcattgactccattgaaaagagccacaaaactgtc
tttgtgctttctgaaaactttgtgaagagtgagtggtgcaagtatgaactggacttctcc
catttccgtctttttgatgagaacaatgatgctgccattctcattcttctggagcccatt
gagaaaaaagccattccccagcgcttctgcaagctgcggaagataatgaacaccaagacc
tacctggagtggcccatggacgaggctcagcgggaaggattttgggtaaatctgagagct
gcgataaagtcctag

DBGET integrated database retrieval system