KEGG   Homo sapiens (human): 7100Help
Entry
7100              CDS       T01001                                 

Gene name
TLR5, MELIOS, SLEB1, TIL3
Definition
toll-like receptor 5
Orthology
K10168  
toll-like receptor 5
Organism
hsa  Homo sapiens (human)
Pathway
Toll-like receptor signaling pathway
Pathogenic Escherichia coli infection
Salmonella infection
Legionellosis
Inflammatory bowel disease (IBD)
Disease
H00080  
Systemic lupus erythematosus
Drug target
Other: 
Class
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:hsa04620]
Human Diseases; Immune diseases; Inflammatiory bowel disease (IBD) [PATH:hsa05321]
Human Diseases; Infectious diseases; Pathogenic Escherichia coli infection [PATH:hsa05130]
Human Diseases; Infectious diseases; Salmonella infection [PATH:hsa05132]
Human Diseases; Infectious diseases; Legionellosis [PATH:hsa05134]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q41-q42
AA seq 858 aa AA seqDB search
MGDHLDLLLGVVLMAGPVFGIPSCSFDGRIAFYRFCNLTQVPQVLNTTERLLLSFNYIRT
VTASSFPFLEQLQLLELGSQYTPLTIDKEAFRNLPNLRILDLGSSKIYFLHPDAFQGLFH
LFELRLYFCGLSDAVLKDGYFRNLKALTRLDLSKNQIRSLYLHPSFGKLNSLKSIDFSSN
QIFLVCEHELEPLQGKTLSFFSLAANSLYSRVSVDWGKCMNPFRNMVLEILDVSGNGWTV
DITGNFSNAISKSQAFSLILAHHIMGAGFGFHNIKDPDQNTFAGLARSSVRHLDLSHGFV
FSLNSRVFETLKDLKVLNLAYNKINKIADEAFYGLDNLQVLNLSYNLLGELYSSNFYGLP
KVAYIDLQKNHIAIIQDQTFKFLEKLQTLDLRDNALTTIHFIPSIPDIFLSGNKLVTLPK
INLTANLIHLSENRLENLDILYFLLRVPHLQILILNQNRFSSCSGDQTPSENPSLEQLFL
GENMLQLAWETELCWDVFEGLSHLQVLYLNHNYLNSLPPGVFSHLTALRGLSLNSNRLTV
LSHNDLPANLEILDISRNQLLAPNPDVFVSLSVLDITHNKFICECELSTFINWLNHTNVT
IAGPPADIYCVYPDSFSGVSLFSLSTEGCDEEEVLKSLKFSLFIVCTVTLTLFLMTILTV
TKFRGFCFICYKTAQRLVFKDHPQGTEPDMYKYDAYLCFSSKDFTWVQNALLKHLDTQYS
DQNRFNLCFEERDFVPGENRIANIQDAIWNSRKIVCLVSRHFLRDGWCLEAFSYAQGRCL
SDLNSALIMVVVGSLSQYQLMKHQSIRGFVQKQQYLRWPEDLQDVGWFLHKLSQQILKKE
KEKKKDNNIPLQTVATIS
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atgggagaccacctggaccttctcctaggagtggtgctcatggccggtcctgtgtttgga
attccttcctgctcctttgatggccgaatagccttttatcgtttctgcaacctcacccag
gtcccccaggtcctcaacaccactgagaggctcctgctgagcttcaactatatcaggaca
gtcactgcttcatccttcccctttctggaacagctgcagctgctggagctcgggagccag
tatacccccttgactattgacaaggaggccttcagaaacctgcccaaccttagaatcttg
gacctgggaagtagtaagatatacttcttgcatccagatgcttttcagggactgttccat
ctgtttgaacttagactgtatttctgtggtctctctgatgctgtattgaaagatggttat
ttcagaaatttaaaggctttaactcgcttggatctatccaaaaatcagattcgtagcctt
taccttcatccttcatttgggaagttgaattccttaaagtccatagatttttcctccaac
caaatattccttgtatgtgaacatgagctcgagcccctacaagggaaaacgctctccttt
tttagcctcgcagctaatagcttgtatagcagagtctcagtggactggggaaaatgtatg
aacccattcagaaacatggtgctggagatactagatgtttctggaaatggctggacagtg
gacatcacaggaaactttagcaatgccatcagcaaaagccaggccttctctttgattctt
gcccaccacatcatgggtgccgggtttggcttccataacatcaaagatcctgaccagaac
acatttgctggcctggccagaagttcagtgagacacctggatctttcacatgggtttgtc
ttctccctgaactcacgagtctttgagacactcaaggatttgaaggttctgaaccttgcc
tacaacaagataaataagattgcagatgaagcattttacggacttgacaacctccaagtt
ctcaatttgtcatataaccttctgggggaactttacagttcgaatttctatggactacct
aaggtagcctacattgatttgcaaaagaatcacattgcaataattcaagaccaaacattc
aaattcctggaaaaattacagaccttggatctccgagacaatgctcttacaaccattcat
tttattccaagcatacccgatatcttcttgagtggcaataaactagtgactttgccaaag
atcaaccttacagcgaacctcatccacttatcagaaaacaggctagaaaatctagatatt
ctctactttctcctacgggtacctcatctccagattctcattttaaatcaaaatcgcttc
tcctcctgtagtggagatcaaaccccttcagagaatcccagcttagaacagcttttcctt
ggagaaaatatgttgcaacttgcctgggaaactgagctctgttgggatgtttttgaggga
ctttctcatcttcaagttctgtatttgaatcataactatcttaattcccttccaccagga
gtatttagccatctgactgcattaaggggactaagcctcaactccaacaggctgacagtt
ctttctcacaatgatttacctgctaatttagagatcctggacatatccaggaaccagctc
ctagctcctaatcctgatgtatttgtatcacttagtgtcttggatataactcataacaag
ttcatttgtgaatgtgaacttagcacttttatcaattggcttaatcacaccaatgtcact
atagctgggcctcctgcagacatatattgtgtgtaccctgactcgttctctggggtttcc
ctcttctctctttccacggaaggttgtgatgaagaggaagtcttaaagtccctaaagttc
tcccttttcattgtatgcactgtcactctgactctgttcctcatgaccatcctcacagtc
acaaagttccggggcttctgttttatctgttataagacagcccagagactggtgttcaag
gaccatccccagggcacagaacctgatatgtacaaatatgatgcctatttgtgcttcagc
agcaaagacttcacatgggtgcagaatgctttgctcaaacacctggacactcaatacagt
gaccaaaacagattcaacctgtgctttgaagaaagagactttgtcccaggagaaaaccgc
attgccaatatccaggatgccatctggaacagtagaaagatcgtttgtcttgtgagcaga
cacttccttagagatggctggtgccttgaagccttcagttatgcccagggcaggtgctta
tctgaccttaacagtgctctcatcatggtggtggttgggtccttgtcccagtaccagttg
atgaaacatcaatccatcagaggctttgtacagaaacagcagtatttgaggtggcctgag
gatctccaggatgttggctggtttcttcataaactctctcaacagatactaaagaaagaa
aaagaaaagaagaaagacaataacattccgttgcaaactgtagcaaccatctcctaa

DBGET integrated database retrieval system