KEGG   Homo sapiens (human): 7100Help
Entry
7100              CDS       T01001                                 

Gene name
TLR5, MELIOS, SLE1, SLEB1, TIL3
Definition
(RefSeq) toll like receptor 5
  KO
K10168  toll-like receptor 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04620  Toll-like receptor signaling pathway
hsa05130  Pathogenic Escherichia coli infection
hsa05132  Salmonella infection
hsa05134  Legionellosis
hsa05321  Inflammatory bowel disease (IBD)
Disease
H00080  Systemic lupus erythematosus
Drug target
Entolimod: D10368
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    7100 (TLR5)
 Human Diseases
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    7100 (TLR5)
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    7100 (TLR5)
   05132 Salmonella infection
    7100 (TLR5)
   05134 Legionellosis
    7100 (TLR5)
Pattern recognition receptors [BR:hsa04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   7100 (TLR5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 TIR LRR_4 LRR_5 LRR_9 LRR_1 TIR_2
Motif
Other DBs
NCBI-GeneID: 7100
NCBI-ProteinID: NP_003259
OMIM: 603031
HGNC: 11851
Ensembl: ENSG00000187554
Vega: OTTHUMG00000037937
Pharos: O60602(Tbio)
UniProt: O60602
Structure
PDB: 

Jmol
Position
1q41
AA seq 858 aa AA seqDB search
MGDHLDLLLGVVLMAGPVFGIPSCSFDGRIAFYRFCNLTQVPQVLNTTERLLLSFNYIRT
VTASSFPFLEQLQLLELGSQYTPLTIDKEAFRNLPNLRILDLGSSKIYFLHPDAFQGLFH
LFELRLYFCGLSDAVLKDGYFRNLKALTRLDLSKNQIRSLYLHPSFGKLNSLKSIDFSSN
QIFLVCEHELEPLQGKTLSFFSLAANSLYSRVSVDWGKCMNPFRNMVLEILDVSGNGWTV
DITGNFSNAISKSQAFSLILAHHIMGAGFGFHNIKDPDQNTFAGLARSSVRHLDLSHGFV
FSLNSRVFETLKDLKVLNLAYNKINKIADEAFYGLDNLQVLNLSYNLLGELYSSNFYGLP
KVAYIDLQKNHIAIIQDQTFKFLEKLQTLDLRDNALTTIHFIPSIPDIFLSGNKLVTLPK
INLTANLIHLSENRLENLDILYFLLRVPHLQILILNQNRFSSCSGDQTPSENPSLEQLFL
GENMLQLAWETELCWDVFEGLSHLQVLYLNHNYLNSLPPGVFSHLTALRGLSLNSNRLTV
LSHNDLPANLEILDISRNQLLAPNPDVFVSLSVLDITHNKFICECELSTFINWLNHTNVT
IAGPPADIYCVYPDSFSGVSLFSLSTEGCDEEEVLKSLKFSLFIVCTVTLTLFLMTILTV
TKFRGFCFICYKTAQRLVFKDHPQGTEPDMYKYDAYLCFSSKDFTWVQNALLKHLDTQYS
DQNRFNLCFEERDFVPGENRIANIQDAIWNSRKIVCLVSRHFLRDGWCLEAFSYAQGRCL
SDLNSALIMVVVGSLSQYQLMKHQSIRGFVQKQQYLRWPEDLQDVGWFLHKLSQQILKKE
KEKKKDNNIPLQTVATIS
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atgggagaccacctggaccttctcctaggagtggtgctcatggccggtcctgtgtttgga
attccttcctgctcctttgatggccgaatagccttttatcgtttctgcaacctcacccag
gtcccccaggtcctcaacaccactgagaggctcctgctgagcttcaactatatcaggaca
gtcactgcttcatccttcccctttctggaacagctgcagctgctggagctcgggagccag
tatacccccttgactattgacaaggaggccttcagaaacctgcccaaccttagaatcttg
gacctgggaagtagtaagatatacttcttgcatccagatgcttttcagggactgttccat
ctgtttgaacttagactgtatttctgtggtctctctgatgctgtattgaaagatggttat
ttcagaaatttaaaggctttaactcgcttggatctatccaaaaatcagattcgtagcctt
taccttcatccttcatttgggaagttgaattccttaaagtccatagatttttcctccaac
caaatattccttgtatgtgaacatgagctcgagcccctacaagggaaaacgctctccttt
tttagcctcgcagctaatagcttgtatagcagagtctcagtggactggggaaaatgtatg
aacccattcagaaacatggtgctggagatactagatgtttctggaaatggctggacagtg
gacatcacaggaaactttagcaatgccatcagcaaaagccaggccttctctttgattctt
gcccaccacatcatgggtgccgggtttggcttccataacatcaaagatcctgaccagaac
acatttgctggcctggccagaagttcagtgagacacctggatctttcacatgggtttgtc
ttctccctgaactcacgagtctttgagacactcaaggatttgaaggttctgaaccttgcc
tacaacaagataaataagattgcagatgaagcattttacggacttgacaacctccaagtt
ctcaatttgtcatataaccttctgggggaactttacagttcgaatttctatggactacct
aaggtagcctacattgatttgcaaaagaatcacattgcaataattcaagaccaaacattc
aaattcctggaaaaattacagaccttggatctccgagacaatgctcttacaaccattcat
tttattccaagcatacccgatatcttcttgagtggcaataaactagtgactttgccaaag
atcaaccttacagcgaacctcatccacttatcagaaaacaggctagaaaatctagatatt
ctctactttctcctacgggtacctcatctccagattctcattttaaatcaaaatcgcttc
tcctcctgtagtggagatcaaaccccttcagagaatcccagcttagaacagcttttcctt
ggagaaaatatgttgcaacttgcctgggaaactgagctctgttgggatgtttttgaggga
ctttctcatcttcaagttctgtatttgaatcataactatcttaattcccttccaccagga
gtatttagccatctgactgcattaaggggactaagcctcaactccaacaggctgacagtt
ctttctcacaatgatttacctgctaatttagagatcctggacatatccaggaaccagctc
ctagctcctaatcctgatgtatttgtatcacttagtgtcttggatataactcataacaag
ttcatttgtgaatgtgaacttagcacttttatcaattggcttaatcacaccaatgtcact
atagctgggcctcctgcagacatatattgtgtgtaccctgactcgttctctggggtttcc
ctcttctctctttccacggaaggttgtgatgaagaggaagtcttaaagtccctaaagttc
tcccttttcattgtatgcactgtcactctgactctgttcctcatgaccatcctcacagtc
acaaagttccggggcttctgttttatctgttataagacagcccagagactggtgttcaag
gaccatccccagggcacagaacctgatatgtacaaatatgatgcctatttgtgcttcagc
agcaaagacttcacatgggtgcagaatgctttgctcaaacacctggacactcaatacagt
gaccaaaacagattcaacctgtgctttgaagaaagagactttgtcccaggagaaaaccgc
attgccaatatccaggatgccatctggaacagtagaaagatcgtttgtcttgtgagcaga
cacttccttagagatggctggtgccttgaagccttcagttatgcccagggcaggtgctta
tctgaccttaacagtgctctcatcatggtggtggttgggtccttgtcccagtaccagttg
atgaaacatcaatccatcagaggctttgtacagaaacagcagtatttgaggtggcctgag
gatctccaggatgttggctggtttcttcataaactctctcaacagatactaaagaaagaa
aaagaaaagaagaaagacaataacattccgttgcaaactgtagcaaccatctcctaa

DBGET integrated database retrieval system