KEGG   Homo sapiens (human): 7102Help
Entry
7102              CDS       T01001                                 

Gene name
TSPAN7, A15, CCG-B7, CD231, DXS1692E, MRX58, MXS1, TALLA-1, TM4SF2, TM4SF2b
Definition
tetraspanin 7
Orthology
K06571  
tetraspanin-7
Organism
hsa  Homo sapiens (human)
Pathway
Transcriptional misregulation in cancer
Disease
H00480  
Non-syndromic X-linked mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    7102 (TSPAN7)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   7102 (TSPAN7)
Cellular antigens [BR:hsa04090]
 Proteins
  7102 (TSPAN7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xp11.4
AA seq 249 aa AA seqDB search
MASRRMETKPVITCLKTLLIIYSFVFWITGVILLAVGVWGKLTLGTYISLIAENSTNAPY
VLIGTGTTIVVFGLFGCFATCRGSPWMLKLYAMFLSLVFLAELVAGISGFVFRHEIKDTF
LRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETD
CNPQDLHNLTVAATKVNQKGCYDLVTSFMETNMGIIAGVAFGIAFSQLIGMLLACCLSRF
ITANQYEMV
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgaggagaatggagaccaaacctgtgataacctgtctcaaaaccctcctcatc
atctactccttcgtcttctggatcactggggtgatcctgctggctgttggagtctggggc
aaacttactctgggcacctatatctcccttattgccgagaactccacaaatgctccctat
gtgctcatcggaactggcaccactattgttgtctttggcctgtttggatgctttgctaca
tgtcgtggtagcccatggatgctgaaactgtatgccatgtttctgtccctggtgttcctg
gctgagctcgtagctggcatttcagggtttgtgtttcgtcatgagatcaaggacaccttc
ctgaggacttacacggacgctatgcagacttacaatggcaatgatgagaggagccgggca
gtggaccatgtgcagcgcagcctgagctgctgtggtgtgcagaactacaccaactggagc
accagcccctacttcctggagcatggcatcccccccagctgctgcatgaacgaaactgat
tgtaatccccaggatctacacaatctgactgtggccgccaccaaagttaaccagaagggt
tgttatgatctggtaactagtttcatggagactaacatgggaatcatcgctggagtggcg
tttggaatcgcattctcccagttaattggcatgctgctggcctgctgtctgtcccggttc
atcacggccaatcagtatgagatggtgtaa

DBGET integrated database retrieval system