KEGG   Homo sapiens (human): 7108Help
Entry
7108              CDS       T01001                                 

Gene name
TM7SF2, ANG1, DHCR14A, NET47
Definition
transmembrane 7 superfamily member 2 (EC:1.3.1.70)
Orthology
K00222  
delta14-sterol reductase [EC:1.3.1.70]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid biosynthesis
Metabolic pathways
Module
Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    7108 (TM7SF2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     7108 (TM7SF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q13
AA seq 391 aa AA seqDB search
MAPTQGPRAPLEFGGPLGAAALLLLLPATMFHLLLAARSGPARLLGPPASLPGLEVLWSP
RALLLWLAWLGLQAALYLLPARKVAEGQELKDKSRLRYPINGFQALVLTALLVGLGMSAG
LPLGALPEMLLPLAFVATLTAFIFSLFLYMKAQVAPVSALAPGGNSGNPIYDFFLGRELN
PRICFFDFKYFCELRPGLIGWVLINLALLMKEAELRGSPSLAMWLVNGFQLLYVGDALWH
EEAVLTTMDITHDGFGFMLAFGDMAWVPFTYSLQAQFLLHHPQPLGLPMASVICLINGLE
TISTATGRKLLVSGWWGMVRHPNYLGDLIMALAWSLPCGVSHLLPYFYLLYFTALLVHRE
ARDERQCLQKYGLAWQEYCRRVPYRIMPYIY
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcccccactcagggcccccgggccccgctggaattcggagggcccctgggcgccgcg
gctctgctactgctgctgcccgccaccatgttccacctgctcctggcggcccgttcgggc
cccgcgcgcctgctgggtccacccgcgtccctgcccgggctggaggtgctgtggagccca
cgggcgctgctgctgtggctcgcctggctcggcctgcaggcggcgctctacctactgccg
gcgcgcaaggtggccgaggggcaggaattgaaggacaagagtcgcctgcgctatcctatt
aacggcttccaggccctggtgctgacagccctgttggtggggctggggatgtcagcgggg
ctgcctctgggggcgctcccggaaatgctcctgcccttggcgtttgtcgccaccctcacc
gctttcatcttcagcctctttctctacatgaaggcgcaggtagccccagtttcggccctg
gcacctggggggaactcaggcaatccgatttacgacttttttctgggacgagagctcaac
cctcgtatctgtttcttcgacttcaaatatttctgtgaactgcgacccggcctcatcggc
tgggtcctcatcaacctggccctgttgatgaaggaggcagagcttcgaggcagtccctca
ctggccatgtggctggtcaatggcttccagttgctctacgtgggtgatgccctctggcac
gaggaggccgtcctcaccaccatggatatcacacatgacgggtttggcttcatgctggcg
tttggggacatggcctgggtgcccttcacctacagcctgcaggcccagttcctgctgcac
cacccgcagcccctggggttgcccatggcctctgtcatctgcctcatcaatgggcttgag
accatctctacagccacagggcggaaactgctggtgtctgggtggtggggtatggtccgc
catcccaactatcttggagacctcatcatggctctggcttggtccttgccctgcggggtg
tcacacctgctgccctacttctacctcctctacttcaccgcgctgctggtgcaccgtgag
gcccgggatgagcggcagtgcctgcagaagtacggcctggcctggcaggagtactgccgg
cgtgtgccttaccgcatcatgccctacatctactga

DBGET integrated database retrieval system