KEGG   Homo sapiens (human): 7128Help
Entry
7128              CDS       T01001                                 

Gene name
TNFAIP3, A20, OTUD7C, TNFA1P2
Definition
tumor necrosis factor, alpha-induced protein 3 (EC:3.4.19.12)
Orthology
K11859  
tumor necrosis factor, alpha-induced protein 3 [EC:3.4.19.12 6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
NOD-like receptor signaling pathway
TNF signaling pathway
Measles
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    7128 (TNFAIP3)
   04668 TNF signaling pathway
    7128 (TNFAIP3)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    7128 (TNFAIP3)
 Human Diseases
  Infectious diseases
   05162 Measles
    7128 (TNFAIP3)
   05169 Epstein-Barr virus infection
    7128 (TNFAIP3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     7128 (TNFAIP3)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     7128 (TNFAIP3)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C64
   7128 (TNFAIP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q23
AA seq 790 aa AA seqDB search
MAEQVLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKTMHRYTLEMFRTCQFCPQF
REIIHKALIDRNIQATLESQKKLNWCREVRKLVALKTNGDGNCLMHATSQYMWGVQDTDL
VLRKALFSTLKETDTRNFKFRWQLESLKSQEFVETGLCYDTRNWNDEWDNLIKMASTDTP
MARSGLQYNSLEEIHIFVLCNILRRPIIVISDKMLRSLESGSNFAPLKVGGIYLPLHWPA
QECYRYPIVLGYDSHHFVPLVTLKDSGPEIRAVPLVNRDRGRFEDLKVHFLTDPENEMKE
KLLKEYLMVIEIPVQGWDHGTTHLINAAKLDEANLPKEINLVDDYFELVQHEYKKWQENS
EQGRREGHAQNPMEPSVPQLSLMDVKCETPNCPFFMSVNTQPLCHECSERRQKNQNKLPK
LNSKPGPEGLPGMALGASRGEAYEPLAWNPEESTGGPHSAPPTAPSPFLFSETTAMKCRS
PGCPFTLNVQHNGFCERCHNARQLHASHAPDHTRHLDPGKCQACLQDVTRTFNGICSTCF
KRTTAEASSSLSTSLPPSCHQRSKSDPSRLVRSPSPHSCHRAGNDAPAGCLSQAARTPGD
RTGTSKCRKAGCVYFGTPENKGFCTLCFIEYRENKHFAAASGKVSPTASRFQNTIPCLGR
ECGTLGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQRRDVPRTTQSTSRPKCARAS
CKNILACRSEELCMECQHPNQRMGPGAHRGEPAPEDPPKQRCRAPACDHFGNAKCNGYCN
ECFQFKQMYG
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacaagtccttcctcaggctttgtatttgagcaatatgcggaaagctgtgaag
atacgggagagaactccagaagacatttttaaacctactaatgggatcattcatcatttt
aaaaccatgcaccgatacacactggaaatgttcagaacttgccagttttgtcctcagttt
cgggagatcatccacaaagccctcatcgacagaaacatccaggccaccctggaaagccag
aagaaactcaactggtgtcgagaagtccggaagcttgtggcgctgaaaacgaacggtgac
ggcaattgcctcatgcatgccacttctcagtacatgtggggcgttcaggacacagacttg
gtactgaggaaggcgctgttcagcacgctcaaggaaacagacacacgcaactttaaattc
cgctggcaactggagtctctcaaatctcaggaatttgttgaaacggggctttgctatgat
actcggaactggaatgatgaatgggacaatcttatcaaaatggcttccacagacacaccc
atggcccgaagtggacttcagtacaactcactggaagaaatacacatatttgtcctttgc
aacatcctcagaaggccaatcattgtcatttcagacaaaatgctaagaagtttggaatca
ggttccaatttcgcccctttgaaagtgggtggaatttacttgcctctccactggcctgcc
caggaatgctacagataccccattgttctcggctatgacagccatcattttgtacccttg
gtgaccctgaaggacagtgggcctgaaatccgagctgttccacttgttaacagagaccgg
ggaagatttgaagacttaaaagttcactttttgacagatcctgaaaatgagatgaaggag
aagctcttaaaagagtacttaatggtgatagaaatccccgtccaaggctgggaccatggc
acaactcatctcatcaatgccgcaaagttggatgaagctaacttaccaaaagaaatcaat
ctggtagatgattactttgaacttgttcagcatgagtacaagaaatggcaggaaaacagc
gagcaggggaggagagaggggcacgcccagaatcccatggaaccttccgtgccccagctt
tctctcatggatgtaaaatgtgaaacgcccaactgccccttcttcatgtctgtgaacacc
cagcctttatgccatgagtgctcagagaggcggcaaaagaatcaaaacaaactcccaaag
ctgaactccaagccgggccctgaggggctccctggcatggcgctcggggcctctcgggga
gaagcctatgagcccttggcgtggaaccctgaggagtccactggggggcctcattcggcc
ccaccgacagcacccagcccttttctgttcagtgagaccactgccatgaagtgcaggagc
cccggctgccccttcacactgaatgtgcagcacaacggattttgtgaacgttgccacaac
gcccggcaacttcacgccagccacgccccagaccacacaaggcacttggatcccgggaag
tgccaagcctgcctccaggatgttaccaggacatttaatgggatctgcagtacttgcttc
aaaaggactacagcagaggcctcctccagcctcagcaccagcctccctccttcctgtcac
cagcgttccaagtcagatccctcgcggctcgtccggagcccctccccgcattcttgccac
agagctggaaacgacgcccctgctggctgcctgtctcaagctgcacggactcctggggac
aggacggggacgagcaagtgcagaaaagccggctgcgtgtattttgggactccagaaaac
aagggcttttgcacactgtgtttcatcgagtacagagaaaacaaacattttgctgctgcc
tcagggaaagtcagtcccacagcgtccaggttccagaacaccattccgtgcctggggagg
gaatgcggcacccttggaagcaccatgtttgaaggatactgccagaagtgtttcattgaa
gctcagaatcagagatttcatgaggccaaaaggacagaagagcaactgagatcgagccag
cgcagagatgtgcctcgaaccacacaaagcacctcaaggcccaagtgcgcccgggcctcc
tgcaagaacatcctggcctgccgcagcgaggagctctgcatggagtgtcagcatcccaac
cagaggatgggccctggggcccaccggggtgagcctgcccccgaagacccccccaagcag
cgttgccgggcccccgcctgtgatcattttggcaatgccaagtgcaacggctactgcaac
gaatgctttcagttcaagcagatgtatggctaa

DBGET integrated database retrieval system