KEGG   Homo sapiens (human): 7128Help
Entry
7128              CDS       T01001                                 

Gene name
TNFAIP3, A20, OTUD7C, TNFA1P2
Definition
tumor necrosis factor, alpha-induced protein 3 (EC:3.4.19.12)
Orthology
K11859  
tumor necrosis factor, alpha-induced protein 3 [EC:3.-.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
NOD-like receptor signaling pathway
TNF signaling pathway
Measles
Epstein-Barr virus infection
Class
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:hsa04064]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:hsa04668]
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:hsa04621]
Human Diseases; Infectious diseases; Measles [PATH:hsa05162]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hsa05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q23
AA seq 790 aa AA seqDB search
MAEQVLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKTMHRYTLEMFRTCQFCPQF
REIIHKALIDRNIQATLESQKKLNWCREVRKLVALKTNGDGNCLMHATSQYMWGVQDTDL
VLRKALFSTLKETDTRNFKFRWQLESLKSQEFVETGLCYDTRNWNDEWDNLIKMASTDTP
MARSGLQYNSLEEIHIFVLCNILRRPIIVISDKMLRSLESGSNFAPLKVGGIYLPLHWPA
QECYRYPIVLGYDSHHFVPLVTLKDSGPEIRAVPLVNRDRGRFEDLKVHFLTDPENEMKE
KLLKEYLMVIEIPVQGWDHGTTHLINAAKLDEANLPKEINLVDDYFELVQHEYKKWQENS
EQGRREGHAQNPMEPSVPQLSLMDVKCETPNCPFFMSVNTQPLCHECSERRQKNQNKLPK
LNSKPGPEGLPGMALGASRGEAYEPLAWNPEESTGGPHSAPPTAPSPFLFSETTAMKCRS
PGCPFTLNVQHNGFCERCHNARQLHASHAPDHTRHLDPGKCQACLQDVTRTFNGICSTCF
KRTTAEASSSLSTSLPPSCHQRSKSDPSRLVRSPSPHSCHRAGNDAPAGCLSQAARTPGD
RTGTSKCRKAGCVYFGTPENKGFCTLCFIEYRENKHFAAASGKVSPTASRFQNTIPCLGR
ECGTLGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQRRDVPRTTQSTSRPKCARAS
CKNILACRSEELCMECQHPNQRMGPGAHRGEPAPEDPPKQRCRAPACDHFGNAKCNGYCN
ECFQFKQMYG
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacaagtccttcctcaggctttgtatttgagcaatatgcggaaagctgtgaag
atacgggagagaactccagaagacatttttaaacctactaatgggatcattcatcatttt
aaaaccatgcaccgatacacactggaaatgttcagaacttgccagttttgtcctcagttt
cgggagatcatccacaaagccctcatcgacagaaacatccaggccaccctggaaagccag
aagaaactcaactggtgtcgagaagtccggaagcttgtggcgctgaaaacgaacggtgac
ggcaattgcctcatgcatgccacttctcagtacatgtggggcgttcaggacacagacttg
gtactgaggaaggcgctgttcagcacgctcaaggaaacagacacacgcaactttaaattc
cgctggcaactggagtctctcaaatctcaggaatttgttgaaacggggctttgctatgat
actcggaactggaatgatgaatgggacaatcttatcaaaatggcttccacagacacaccc
atggcccgaagtggacttcagtacaactcactggaagaaatacacatatttgtcctttgc
aacatcctcagaaggccaatcattgtcatttcagacaaaatgctaagaagtttggaatca
ggttccaatttcgcccctttgaaagtgggtggaatttacttgcctctccactggcctgcc
caggaatgctacagataccccattgttctcggctatgacagccatcattttgtacccttg
gtgaccctgaaggacagtgggcctgaaatccgagctgttccacttgttaacagagaccgg
ggaagatttgaagacttaaaagttcactttttgacagatcctgaaaatgagatgaaggag
aagctcttaaaagagtacttaatggtgatagaaatccccgtccaaggctgggaccatggc
acaactcatctcatcaatgccgcaaagttggatgaagctaacttaccaaaagaaatcaat
ctggtagatgattactttgaacttgttcagcatgagtacaagaaatggcaggaaaacagc
gagcaggggaggagagaggggcacgcccagaatcccatggaaccttccgtgccccagctt
tctctcatggatgtaaaatgtgaaacgcccaactgccccttcttcatgtctgtgaacacc
cagcctttatgccatgagtgctcagagaggcggcaaaagaatcaaaacaaactcccaaag
ctgaactccaagccgggccctgaggggctccctggcatggcgctcggggcctctcgggga
gaagcctatgagcccttggcgtggaaccctgaggagtccactggggggcctcattcggcc
ccaccgacagcacccagcccttttctgttcagtgagaccactgccatgaagtgcaggagc
cccggctgccccttcacactgaatgtgcagcacaacggattttgtgaacgttgccacaac
gcccggcaacttcacgccagccacgccccagaccacacaaggcacttggatcccgggaag
tgccaagcctgcctccaggatgttaccaggacatttaatgggatctgcagtacttgcttc
aaaaggactacagcagaggcctcctccagcctcagcaccagcctccctccttcctgtcac
cagcgttccaagtcagatccctcgcggctcgtccggagcccctccccgcattcttgccac
agagctggaaacgacgcccctgctggctgcctgtctcaagctgcacggactcctggggac
aggacggggacgagcaagtgcagaaaagccggctgcgtgtattttgggactccagaaaac
aagggcttttgcacactgtgtttcatcgagtacagagaaaacaaacattttgctgctgcc
tcagggaaagtcagtcccacagcgtccaggttccagaacaccattccgtgcctggggagg
gaatgcggcacccttggaagcaccatgtttgaaggatactgccagaagtgtttcattgaa
gctcagaatcagagatttcatgaggccaaaaggacagaagagcaactgagatcgagccag
cgcagagatgtgcctcgaaccacacaaagcacctcaaggcccaagtgcgcccgggcctcc
tgcaagaacatcctggcctgccgcagcgaggagctctgcatggagtgtcagcatcccaac
cagaggatgggccctggggcccaccggggtgagcctgcccccgaagacccccccaagcag
cgttgccgggcccccgcctgtgatcattttggcaatgccaagtgcaacggctactgcaac
gaatgctttcagttcaagcagatgtatggctaa

DBGET integrated database retrieval system