KEGG   Homo sapiens (human): 7132Help
Entry
7132              CDS       T01001                                 

Gene name
TNFRSF1A, CD120a, FPF, TBP1, TNF-R, TNF-R-I, TNF-R55, TNFAR, TNFR1, TNFR55, TNFR60, p55, p55-R, p60
Definition
(RefSeq) TNF receptor superfamily member 1A
  KO
K03158  
tumor necrosis factor receptor superfamily member 1A
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
NF-kappa B signaling pathway
Sphingolipid signaling pathway
mTOR signaling pathway
Apoptosis
Apoptosis - multiple species
Necroptosis
Osteoclast differentiation
TNF signaling pathway
Adipocytokine signaling pathway
Insulin resistance
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Amyotrophic lateral sclerosis (ALS)
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Hepatitis C
Influenza A
Human papillomavirus infection
HTLV-I infection
Kaposi's sarcoma-associated herpesvirus infection
Herpes simplex infection
Fluid shear stress and atherosclerosis
Disease
H00912  
Tumor necrosis factor receptor-associated periodic syndrome (TRAPS)
H01490  
Multiple sclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    7132 (TNFRSF1A)
   04064 NF-kappa B signaling pathway
    7132 (TNFRSF1A)
   04668 TNF signaling pathway
    7132 (TNFRSF1A)
   04071 Sphingolipid signaling pathway
    7132 (TNFRSF1A)
   04150 mTOR signaling pathway
    7132 (TNFRSF1A)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7132 (TNFRSF1A)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    7132 (TNFRSF1A)
   04215 Apoptosis - multiple species
    7132 (TNFRSF1A)
   04217 Necroptosis
    7132 (TNFRSF1A)
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    7132 (TNFRSF1A)
  Development
   04380 Osteoclast differentiation
    7132 (TNFRSF1A)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    7132 (TNFRSF1A)
   05014 Amyotrophic lateral sclerosis (ALS)
    7132 (TNFRSF1A)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    7132 (TNFRSF1A)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    7132 (TNFRSF1A)
   04931 Insulin resistance
    7132 (TNFRSF1A)
  Infectious diseases
   05152 Tuberculosis
    7132 (TNFRSF1A)
   05166 HTLV-I infection
    7132 (TNFRSF1A)
   05164 Influenza A
    7132 (TNFRSF1A)
   05160 Hepatitis C
    7132 (TNFRSF1A)
   05168 Herpes simplex infection
    7132 (TNFRSF1A)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    7132 (TNFRSF1A)
   05165 Human papillomavirus infection
    7132 (TNFRSF1A)
   05145 Toxoplasmosis
    7132 (TNFRSF1A)
   05142 Chagas disease (American trypanosomiasis)
    7132 (TNFRSF1A)
Cytokine receptors [BR:hsa04050]
 TNF receptor family
  7132 (TNFRSF1A)
CD molecules [BR:hsa04090]
 Proteins
  7132 (TNFRSF1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P19438(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
12p13.31
AA seq 455 aa AA seqDB search
MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCT
KCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVD
RDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECV
SCSNCKKSLECTKLCLPQIENVKGTEDSGTTVLLPLVIFFGLCLLSLLFIGLMYRYQRWK
SKLYSIVCGKSTPEKEGELEGTTTKPLAPNPSFSPTPGFTPTLGFSPVPSSTFTSSSTYT
PGDCPNFAAPRREVAPPYQGADPILATALASDPIPNPLQKWEDSAHKPQSLDTDDPATLY
AVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLEL
LGRVLRDMDLLGCLEDIEEALCGPAALPPAPSLLR
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgggcctctccaccgtgcctgacctgctgctgccactggtgctcctggagctgttggtg
ggaatatacccctcaggggttattggactggtccctcacctaggggacagggagaagaga
gatagtgtgtgtccccaaggaaaatatatccaccctcaaaataattcgatttgctgtacc
aagtgccacaaaggaacctacttgtacaatgactgtccaggcccggggcaggatacggac
tgcagggagtgtgagagcggctccttcaccgcttcagaaaaccacctcagacactgcctc
agctgctccaaatgccgaaaggaaatgggtcaggtggagatctcttcttgcacagtggac
cgggacaccgtgtgtggctgcaggaagaaccagtaccggcattattggagtgaaaacctt
ttccagtgcttcaattgcagcctctgcctcaatgggaccgtgcacctctcctgccaggag
aaacagaacaccgtgtgcacctgccatgcaggtttctttctaagagaaaacgagtgtgtc
tcctgtagtaactgtaagaaaagcctggagtgcacgaagttgtgcctaccccagattgag
aatgttaagggcactgaggactcaggcaccacagtgctgttgcccctggtcattttcttt
ggtctttgccttttatccctcctcttcattggtttaatgtatcgctaccaacggtggaag
tccaagctctactccattgtttgtgggaaatcgacacctgaaaaagagggggagcttgaa
ggaactactactaagcccctggccccaaacccaagcttcagtcccactccaggcttcacc
cccaccctgggcttcagtcccgtgcccagttccaccttcacctccagctccacctatacc
cccggtgactgtcccaactttgcggctccccgcagagaggtggcaccaccctatcagggg
gctgaccccatccttgcgacagccctcgcctccgaccccatccccaacccccttcagaag
tgggaggacagcgcccacaagccacagagcctagacactgatgaccccgcgacgctgtac
gccgtggtggagaacgtgcccccgttgcgctggaaggaattcgtgcggcgcctagggctg
agcgaccacgagatcgatcggctggagctgcagaacgggcgctgcctgcgcgaggcgcaa
tacagcatgctggcgacctggaggcggcgcacgccgcggcgcgaggccacgctggagctg
ctgggacgcgtgctccgcgacatggacctgctgggctgcctggaggacatcgaggaggcg
ctttgcggccccgccgccctcccgcccgcgcccagtcttctcagatga

KEGG   Homo sapiens (human): 7133Help
Entry
7133              CDS       T01001                                 

Gene name
TNFRSF1B, CD120b, TBPII, TNF-R-II, TNF-R75, TNFBR, TNFR1B, TNFR2, TNFR80, p75, p75TNFR
Definition
(RefSeq) TNF receptor superfamily member 1B
  KO
K05141  
tumor necrosis factor receptor superfamily member 1B
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
TNF signaling pathway
Adipocytokine signaling pathway
Amyotrophic lateral sclerosis (ALS)
Disease
H00084  
Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    7133 (TNFRSF1B)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7133 (TNFRSF1B)
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    7133 (TNFRSF1B)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    7133 (TNFRSF1B)
Cytokine receptors [BR:hsa04050]
 TNF receptor family
  7133 (TNFRSF1B)
CD molecules [BR:hsa04090]
 Proteins
  7133 (TNFRSF1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P20333(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
1p36.22
AA seq 461 aa AA seqDB search
MAPVAVWAALAVGLELWAAAHALPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPG
QHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTC
RPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICR
PHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTS
FLLPMGPSPPAEGSTGDFALPVGLIVGVTALGLLIIGVVNCVIMTQVKKKPLCLQREAKV
PHLPADKARGTQGPEQQHLLITAPSSSSSSLESSASALDRRAPTRNQPQAPGVEASGAGE
ARASTGSSDSSPGGHGTQVNVTCIVNVCSSSDHSSQCSSQASSTMGDTDSSPSESPKDEQ
VPFSKEECAFRSQLETPETLLGSTEEKPLPLGVPDAGMKPS
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccgtcgccgtctgggccgcgctggccgtcggactggagctctgggctgcggcg
cacgccttgcccgcccaggtggcatttacaccctacgccccggagcccgggagcacatgc
cggctcagagaatactatgaccagacagctcagatgtgctgcagcaaatgctcgccgggc
caacatgcaaaagtcttctgtaccaagacctcggacaccgtgtgtgactcctgtgaggac
agcacatacacccagctctggaactgggttcccgagtgcttgagctgtggctcccgctgt
agctctgaccaggtggaaactcaagcctgcactcgggaacagaaccgcatctgcacctgc
aggcccggctggtactgcgcgctgagcaagcaggaggggtgccggctgtgcgcgccgctg
cgcaagtgccgcccgggcttcggcgtggccagaccaggaactgaaacatcagacgtggtg
tgcaagccctgtgccccggggacgttctccaacacgacttcatccacggatatttgcagg
ccccaccagatctgtaacgtggtggccatccctgggaatgcaagcatggatgcagtctgc
acgtccacgtcccccacccggagtatggccccaggggcagtacacttaccccagccagtg
tccacacgatcccaacacacgcagccaactccagaacccagcactgctccaagcacctcc
ttcctgctcccaatgggccccagccccccagctgaagggagcactggcgacttcgctctt
ccagttggactgattgtgggtgtgacagccttgggtctactaataataggagtggtgaac
tgtgtcatcatgacccaggtgaaaaagaagcccttgtgcctgcagagagaagccaaggtg
cctcacttgcctgccgataaggcccggggtacacagggccccgagcagcagcacctgctg
atcacagcgccgagctccagcagcagctccctggagagctcggccagtgcgttggacaga
agggcgcccactcggaaccagccacaggcaccaggcgtggaggccagtggggccggggag
gcccgggccagcaccgggagctcagattcttcccctggtggccatgggacccaggtcaat
gtcacctgcatcgtgaacgtctgtagcagctctgaccacagctcacagtgctcctcccaa
gccagctccacaatgggagacacagattccagcccctcggagtccccgaaggacgagcag
gtccccttctccaaggaggaatgtgcctttcggtcacagctggagacgccagagaccctg
ctggggagcaccgaagagaagcccctgccccttggagtgcctgatgctgggatgaagccc
agttaa

DBGET integrated database retrieval system