KEGG   Homo sapiens (human): 7137Help
Entry
7137              CDS       T01001                                 

Gene name
TNNI3, CMD1FF, CMD2A, CMH7, RCM1, TNNC1, cTnI
Definition
troponin I type 3 (cardiac)
Orthology
K12044  
troponin I, cardiac muscle
Organism
hsa  Homo sapiens (human)
Pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
Disease
H00292  
Hypertrophic cardiomyopathy (HCM)
H00294  
Dilated cardiomyopathy (DCM)
H01219  
Restrictive cardiomyopathy (RCM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    7137 (TNNI3)
   04261 Adrenergic signaling in cardiomyocytes
    7137 (TNNI3)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    7137 (TNNI3)
   05414 Dilated cardiomyopathy (DCM)
    7137 (TNNI3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.4
AA seq 210 aa AA seqDB search
MADGSSDAAREPRPAPAPIRRRSSNYRAYATEPHAKKKSKISASRKLQLKTLLLQIAKQE
LEREAEERRGEKGRALSTRCQPLELAGLGFAELQDLCRQLHARVDKVDEERYDIEAKVTK
NITEIADLTQKIFDLRGKFKRPTLRRVRISADAMMQALLGARAKESLDLRAHLKQVKKED
TEKENREVGDWRKNIDALSGMEGRKKKFES
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggcggatgggagcagcgatgcggctagggaacctcgccctgcaccagccccaatcaga
cgccgctcctccaactaccgcgcttatgccacggagccgcacgccaagaaaaaatctaag
atctccgcctcgagaaaattgcagctgaagactctgctgctgcagattgcaaagcaagag
ctggagcgagaggcggaggagcggcgcggagagaaggggcgcgctctgagcacccgctgc
cagccgctggagttggccgggctgggcttcgcggagctgcaggacttgtgccgacagctc
cacgcccgtgtggacaaggtggatgaagagagatacgacatagaggcaaaagtcaccaag
aacatcacggagattgcagatctgactcagaagatctttgaccttcgaggcaagtttaag
cggcccaccctgcggagagtgaggatctctgcagatgccatgatgcaggcgctgctgggg
gcccgggctaaggagtccctggacctgcgggcccacctcaagcaggtgaagaaggaggac
accgagaaggaaaaccgggaggtgggagactggcgcaagaacatcgatgcactgagtgga
atggagggccgcaagaaaaagtttgagagctga

  All links  
No link information was found.   
DBGET integrated database retrieval system