KEGG   Homo sapiens (human): 7143Help
Entry
7143              CDS       T01001                                 

Gene name
TNR, TN-R
Definition
(RefSeq) tenascin R
  KO
K06252  
tenascin
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    7143 (TNR)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    7143 (TNR)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    7143 (TNR)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    7143 (TNR)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   6/5 subfamily
    L1CAM; L1 cell adhesion molecule [KO:K06550]
     7143 (TNR)
  Others
   CXADR, CAR; coxsackievirus and adenovirus receptor [KO:K06788]
    7143 (TNR)
 2. Integrin Family
  Beta1 integrins
   VLA-2
    ITGB1; integrin beta 1 [KO:K05719]
     7143 (TNR)
   VLA-8
     7143 (TNR)
   VLA-9
     7143 (TNR)
  Beta3 integrins
   VNR
    ITGB3; integrin beta 3 [KO:K06493]
     7143 (TNR)
  Beta6 integrins
   alpha V beta 6
    ITGB6; integrin beta 6 [KO:K06589]
     7143 (TNR)
 7. Others
  SDC1; syndecan 1 [KO:K06257]
   7143 (TNR)
  SDC4; syndecan 4 [KO:K16338]
   7143 (TNR)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   7143 (TNR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
1q24
AA seq 1358 aa AA seqDB search
MGADGETVVLKNMLIGINLILLGSMIKPSECQLEVTTERVQRQSVEEEGGIANYNTSSKE
QPVVFNHVYNINVPLDNLCSSGLEASAEQEVSAEDETLAEYMGQTSDHESQVTFTHRINF
PKKACPCASSAQVLQELLSRIEMLEREVSVLRDQCNANCCQESAATGQLDYIPHCSGHGN
FSFESCGCICNEGWFGKNCSEPYCPLGCSSRGVCVDGQCICDSEYSGDDCSELRCPTDCS
SRGLCVDGECVCEEPYTGEDCRELRCPGDCSGKGRCANGTCLCEEGYVGEDCGQRQCLNA
CSGRGQCEEGLCVCEEGYQGPDCSAVAPPEDLRVAGISDRSIELEWDGPMAVTEYVISYQ
PTALGGLQLQQRVPGDWSGVTITELEPGLTYNISVYAVISNILSLPITAKVATHLSTPQG
LQFKTITETTVEVQWEPFSFSFDGWEISFIPKNNEGGVIAQVPSDVTSFNQTGLKPGEEY
IVNVVALKEQARSPPTSASVSTVIDGPTQILVRDVSDTVAFVEWIPPRAKVDFILLKYGL
VGGEGGRTTFRLQPPLSQYSVQALRPGSRYEVSVSAVRGTNESDSATTQFTTEIDAPKNL
RVGSRTATSLDLEWDNSEAEVQEYKVVYSTLAGEQYHEVLVPRGIGPTTRATLTDLVPGT
EYGVGISAVMNSQQSVPATMNARTELDSPRDLMVTASSETSISLIWTKASGPIDHYRITF
TPSSGIASEVTVPKDRTSYTLTDLEPGAEYIISVTAERGRQQSLESTVDAFTGFRPISHL
HFSHVTSSSVNITWSDPSPPADRLILNYSPRDEEEEMMEVSLDATKRHAVLMGLQPATEY
IVNLVAVHGTVTSEPIVGSITTGIDPPKDITISNVTKDSVMVSWSPPVASFDYYRVSYRP
TQVGRLDSSVVPNTVTEFTITRLNPATEYEISLNSVRGREESERICTLVHTAMDNPVDLI
ATNITPTEALLQWKAPVGEVENYVIVLTHFAVAGETILVDGVSEEFRLVDLLPSTHYTAT
MYATNGPLTSGTISTNFSTLLDPPANLTASEVTRQSALISWQPPRAEIENYVLTYKSTDG
SRKELIVDAEDTWIRLEGLLENTDYTVLLQAAQDTTWSSITSTAFTTGGRVFPHPQDCAQ
HLMNGDTLSGVYPIFLNGELSQKLQVYCDMTTDGGGWIVFQRRQNGQTDFFRKWADYRVG
FGNVEDEFWLGLDNIHRITSQGRYELRVDMRDGQEAAFASYDRFSVEDSRNLYKLRIGSY
NGTAGDSLSYHQGRPFSTEDRDNDVAVTNCAMSYKGAWWYKNCHRTNLNGKYGESRHSQG
INWYHWKGHEFSIPFVEMKMRPYNHRLMAGRKRQSLQF
NT seq 4077 nt NT seq  +upstreamnt  +downstreamnt
atgggggcagatggggaaacagtggttctgaagaacatgctcattggcatcaacctgatc
cttctgggctccatgatcaagccttcagagtgtcagctggaggtcaccacagaaagggtc
cagagacagtcagtggaggaggagggaggcattgccaactacaacacatccagcaaagag
cagcctgtggtcttcaaccacgtgtacaacattaacgtgcccttggacaacctctgctcc
tcagggctagaggcctctgctgagcaggaggtgagtgcagaagacgagactctggcagag
tacatgggccagacctcagaccacgagagccaggtcacctttacacacaggatcaacttc
cccaaaaaggcctgtccatgtgccagttcagcccaggtgctgcaggagctgctgagccgg
atcgagatgctggagagggaggtgtcggtgctgcgagaccagtgcaacgccaactgctgc
caagaaagtgctgccacaggacaactggactatatccctcactgcagtggccacggcaac
tttagctttgagtcctgtggctgcatctgcaacgaaggctggtttggcaagaattgctcg
gagccctactgcccgctgggttgctccagccggggggtgtgtgtggatggccagtgcatc
tgtgacagcgagtacagcggggatgactgttccgaactccggtgcccaacagactgcagc
tcccgggggctctgcgtggacggggagtgtgtctgtgaagagccctacactggcgaggac
tgcagggaactgaggtgccctggggactgttcggggaaggggagatgtgccaacggtacc
tgtttatgcgaggagggctacgttggtgaggactgcggccagcggcagtgtctgaatgcc
tgcagtgggcgaggacaatgtgaggaggggctctgcgtctgtgaagagggctaccagggc
cctgactgctcagcagttgcccctccagaggacttgcgagtggctggtatcagcgacagg
tccattgagctggaatgggacgggccgatggcagtgacggaatatgtgatctcttaccag
ccgacggccctggggggcctccagctccagcagcgggtgcctggagattggagtggtgtc
accatcacggagctggagccaggtctcacctacaacatcagcgtctacgctgtcattagc
aacatcctcagccttcccatcactgccaaggtggccacccatctctccactcctcaaggg
ctacaatttaagacgatcacagagaccaccgtggaggtgcagtgggagcccttctcattt
tccttcgatgggtgggaaatcagcttcattccaaagaacaatgaagggggagtgattgct
caggtccccagcgatgttacgtcctttaaccagacaggactaaagcctggggaggaatac
attgtcaatgtggtggctctgaaagaacaggcccgcagcccccctacctcggccagcgtc
tccacagtcattgacggccccacgcagatcctggttcgcgatgtctcggacactgtggct
tttgtggagtggattccccctcgagccaaagtcgatttcattcttttgaaatatggcctg
gtgggcggggaaggtgggaggaccaccttccggctgcagcctcccctgagccaatactca
gtgcaggccctgcggcctggctcccgatacgaggtgtcagtcagtgccgtccgagggacc
aacgagagcgattctgccaccactcagttcacaacagagatcgatgcccccaagaacttg
cgagttggttctcgcacagcaaccagccttgacctcgagtgggataacagtgaagccgaa
gttcaggagtacaaggttgtgtacagcaccctggcgggtgagcaatatcatgaggtactg
gtccccaggggcattggtccaaccaccagggccaccctgacagatctggtacctggcact
gagtatggagttggaatatctgccgtcatgaactcacagcaaagcgtgccagccaccatg
aatgccaggactgaacttgacagtccccgagacctcatggtgacagcctcctcggagacc
tccatctccctcatctggaccaaggccagtggccccattgaccactaccgaattaccttt
accccatcctctgggattgcctcagaagtcaccgtacccaaggacaggacctcatacaca
ctaacagatctagagcctggggcagagtacatcatttccgtcactgctgagaggggtcgg
cagcagagcttggagtccactgtggatgctttcacaggcttccgtcccatctctcatctg
cacttttctcatgtgacctcctccagtgtgaacatcacttggagtgatccatctccccca
gcagacagactcattcttaactacagccccagggatgaggaggaagagatgatggaggtc
tccctggatgccaccaagaggcatgctgtcctgatgggcctgcaaccagccacagagtat
attgtgaaccttgtggctgtccatggcacagtgacctctgagcccattgtgggctccatc
accacaggaattgatcccccaaaagacatcacaattagcaatgtgaccaaggactcagtg
atggtctcctggagccctcctgttgcatctttcgattactaccgagtatcatatcgaccc
acccaagtgggacgactagacagctcagtggtgcccaacactgtgacagaattcaccatc
accagactgaacccagctaccgaatacgaaatcagcctcaacagcgtgcggggcagggag
gaaagcgagcgcatctgtactcttgtgcacacagccatggacaaccctgtggatctgatt
gctaccaatatcactccaacagaagccctgctgcagtggaaggcaccagtgggtgaggtg
gagaactacgtcattgttcttacacactttgcagtcgctggagagaccatccttgttgac
ggagtcagtgaggaatttcggcttgttgacctgcttcctagcacccactatactgccacc
atgtatgccaccaatggacctctcaccagtggcaccatcagcaccaacttttctactctc
ctggaccctccggcaaacctgacagccagtgaagtcaccagacaaagtgccctgatctcc
tggcagcctcccagggcagagattgaaaattatgtcttgacctacaaatccaccgatgga
agccgcaaggagctgattgtggatgcagaagacacctggattcgactggagggcctgttg
gagaacacagactacacggtgctcctgcaggcagcacaggacaccacgtggagcagcatc
acctccaccgctttcaccacaggaggccgggtgttccctcatccccaagactgtgcccag
catttgatgaatggagacactttgagtggggtttaccccatcttcctcaatggggagctg
agccagaaattacaagtgtactgtgatatgaccaccgacgggggcggctggattgtattc
cagaggcggcagaatggccaaactgattttttccggaaatgggctgattaccgtgttggc
ttcgggaacgtggaggatgagttctggctggggctggacaatatacacaggatcacatcc
cagggccgctatgagctgcgcgtggacatgcgggatggccaagaggccgccttcgcctcc
tacgacaggttctctgtcgaggacagcagaaacctgtacaaactccgcataggaagctac
aacggcactgcgggggactccctcagctatcatcaaggacgccctttctccacagaggat
agagacaatgatgttgcagtgactaactgtgccatgtcgtacaagggagcatggtggtat
aagaactgccaccggaccaacctcaatgggaagtacggggagtccaggcacagtcagggc
atcaactggtaccattggaaaggccatgagttctccatcccctttgtggaaatgaagatg
cgcccctacaaccaccgtctcatggcagggagaaaacggcagtccttacagttctga

DBGET integrated database retrieval system