KEGG   Homo sapiens (human): 7148Help
Entry
7148              CDS       T01001                                 

Gene name
TNXB, EDS3, HXBL, TENX, TN-X, TNX, TNXB1, TNXB2, TNXBS, XB, XBS
Definition
tenascin XB
Orthology
K06252  
tenascin
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
MicroRNAs in cancer
Disease
H00802  
Ehlers-Danlos syndrome (EDS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    7148 (TNXB)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    7148 (TNXB)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    7148 (TNXB)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    7148 (TNXB)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  7148 (TNXB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.3
AA seq 4242 aa AA seqDB search
MMPAQYALTSSLVLLVLLSTARAGPFSSRSNVTLPAPRPPPQPGGHTVGAGVGSPSSQLY
EHTVEGGEKQVVFTHRINLPPSTGCGCPPGTEPPVLASEVQALRVRLEILEELVKGLKEQ
CTGGCCPASAQAGTGQTDVRTLCSLHGVFDLSRCTCSCEPGWGGPTCSDPTDAEIPPSSP
PSASGSCPDDCNDQGRCVRGRCVCFPGYTGPSCGWPSCPGDCQGRGRCVQGVCVCRAGFS
GPDCSQRSCPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSCPRGCSQRGRCENGRCVCNPG
YTGEDCGVRSCPRGCSQRGRCKDGRCVCDPGYTGEDCGTRSCPWDCGEGGRCVDGRCVCW
PGYTGEDCSTRTCPRDCRGRGRCEDGECICDTGYSGDDCGVRSCPGDCNQRGRCEDGRCV
CWPGYTGTDCGSRACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSCPGDCRGRGRCESGR
CMCWPGYTGRDCGTRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPGDCRGHGLCED
GVCVCDAGYSGEDCSTRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPNDCSQHGVC
QDGVCICWEGYVSEDCSIRTCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRG
RCVQGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCP
GDCRGRGECHDGSCVCKDGYAGEDCGEEVPTIEGMRMHLLEETTVRTEWTPAPGPVDAYE
IQFIPTTEGASPPFTARVPSSASAYDQRGLAPGQEYQVTVRALRGTSWGLPASKTITTMI
DGPQDLRVVAVTPTTLELGWLRPQAEVDRFVVSYVSAGNQRVRLEVPPEADGTLLTDLMP
GVEYVVTVTAERGRAVSYPASVRANTGSSPLGLLGTTDEPPPSGPSTTQGAQAPLLQQRP
QELGELRVLGRDETGRLRVVWTAQPDTFAYFQLRMRVPEGPGAHEEVLPGDVRQALVPPP
PPGTPYELSLHGVPPGGKPSDPIIYQGIMDKDEEKPGKSSGPPRLGELTVTDRTSDSLLL
RWTVPEGEFDSFVIQYKDRDGQPQVVPVEGPQRSAVITSLDPGRKYKFVLYGFVGKKRHG
PLVAEAKILPQSDPSPGTPPHLGNLWVTDPTPDSLHLSWTVPEGQFDTFMVQYRDRDGRP
QVVPVEGPERSFVVSSLDPDHKYRFTLFGIANKKRYGPLTADGTTAPERKEEPPRPEFLE
QPLLGELTVTGVTPDSLRLSWTVAQGPFDSFMVQYKDAQGQPQAVPVAGDENEVTVPGLD
PDRKYKMNLYGLRGRQRVGPESVVAKTAPQEDVDETPSPTELGTEAPESPEEPLLGELTV
TGSSPDSLSLFWTVPQGSFDSFTVQYKDRDGRPRAVRVGGKESEVTVGGLEPGHKYKMHL
YGLHEGQRVGPVSAVGVTAPQQEETPPATESPLEPRLGELTVTDVTPNSVGLSWTVPEGQ
FDSFIVQYKDKDGQPQVVPVAADQREVTVYNLEPERKYKMNMYGLHDGQRMGPLSVVIVT
APLPPAPATEASKPPLEPRLGELTVTDITPDSVGLSWTVPEGEFDSFVVQYKDRDGQPQV
VPVAADQREVTIPDLEPSRKYKFLLFGIQDGKRRSPVSVEAKTVARGDASPGAPPRLGEL
WVTDPTPDSLRLSWTVPEGQFDSFVVQFKDKDGPQVVPVEGHERSVTVTPLDAGRKYRFL
LYGLLGKKRHGPLTADGTTEARSAMDDTGTKRPPKPRLGEELQVTTVTQNSVGLSWTVPE
GQFDSFVVQYKDRDGQPQVVPVEGSLREVSVPGLDPAHRYKLLLYGLHHGKRVGPISAVA
ITAGREETETETTAPTPPAPEPHLGELTVEEATSHTLHLSWMVTEGEFDSFEIQYTDRDG
QLQMVRIGGDRNDITLSGLESDHRYLVTLYGFSDGKHVGPVHVEALTVPEEEKPSEPPTA
TPEPPIKPRLGELTVTDATPDSLSLSWTVPEGQFDHFLVQYRNGDGQPKAVRVPGHEEGV
TISGLEPDHKYKMNLYGFHGGQRMGPVSVVGVTAAEEETPSPTEPSMEAPEPAEEPLLGE
LTVTGSSPDSLSLSWTVPQGRFDSFTVQYKDRDGRPQVVRVGGEESEVTVGGLEPGRKYK
MHLYGLHEGRRVGPVSAVGVTAPEEESPDAPLAKLRLGQMTVRDITSDSLSLSWTVPEGQ
FDHFLVQFKNGDGQPKAVRVPGHEDGVTISGLEPDHKYKMNLYGFHGGQRVGPVSAVGLT
APGKDEEMAPASTEPPTPEPPIKPRLEELTVTDATPDSLSLSWTVPEGQFDHFLVQYKNG
DGQPKATRVPGHEDRVTISGLEPDNKYKMNLYGFHGGQRVGPVSAIGVTAAEEETPSPTE
PSMEAPEPPEEPLLGELTVTGSSPDSLSLSWTVPQGRFDSFTVQYKDRDGRPQVVRVGGE
ESEVTVGGLEPGRKYKMHLYGLHEGRRVGPVSTVGVTAPQEDVDETPSPTEPGTEAPGPP
EEPLLGELTVTGSSPDSLSLSWTVPQGRFDSFTVQYKDRDGRPQAVRVGGQESKVTVRGL
EPGRKYKMHLYGLHEGRRLGPVSAVGVTEDEAETTQAVPTMTPEPPIKPRLGELTMTDAT
PDSLSLSWTVPEGQFDHFLVQYRNGDGQPKAVRVPGHEDGVTISGLEPDHKYKMNLYGFH
GGQRVGPISVIGVTAAEEETPSPTELSTEAPEPPEEPLLGELTVTGSSPDSLSLSWTIPQ
GHFDSFTVQYKDRDGRPQVMRVRGEESEVTVGGLEPGRKYKMHLYGLHEGRRVGPVSTVG
VTEDEAETTQAVPTTTPEPPNKPRLGELTVTDATPDSLSLSWMVPEGQFDHFLVQYRNGD
GQPKVVRVPGHEDGVTISGLEPDHKYKMNLYGFHGGQRVGPISVIGVTAAEEETPAPTEP
STEAPEPPEEPLLGELTVTGSSPDSLSLSWTIPQGRFDSFTVQYKDRDGRPQVVRVRGEE
SEVTVGGLEPGCKYKMHLYGLHEGQRVGPVSAVGVTAPKDEAETTQAVPTMTPEPPIKPR
LGELTVTDATPDSLSLSWMVPEGQFDHFLVQYRNGDGQPKAVRVPGHEDGVTISGLEPDH
KYKMNLYGFHGGQRVGPVSAIGVTEEETPSPTEPSTEAPEAPEEPLLGELTVTGSSPDSL
SLSWTVPQGRFDSFTVQYKDRDGQPQVVRVRGEESEVTVGGLEPGRKYKMHLYGLHEGQR
VGPVSTVGITAPLPTPLPVEPRLGELAVAAVTSDSVGLSWTVAQGPFDSFLVQYRDAQGQ
PQAVPVSGDLRAVAVSGLDPARKYKFLLFGLQNGKRHGPVPVEARTAPDTKPSPRLGELT
VTDATPDSVGLSWTVPEGEFDSFVVQYKDKDGRLQVVPVAANQREVTVQGLEPSRKYRFL
LYGLSGRKRLGPISADSTTAPLEKELPPHLGELTVAEETSSSLRLSWTVAQGPFDSFVVQ
YRDTDGQPRAVPVAADQRTVTVEDLEPGKKYKFLLYGLLGGKRLGPVSALGMTAPEEDTP
APELAPEAPEPPEEPRLGVLTVTDTTPDSMRLSWSVAQGPFDSFVVQYEDTNGQPQALLV
DGDQSKILISGLEPSTPYRFLLYGLHEGKRLGPLSAEGTTGLAPAGQTSEESRPRLSQLS
VTDVTTSSLRLNWEAPPGAFDSFLLRFGVPSPSTLEPHPRPLLQRELMVPGTRHSAVLRD
LRSGTLYSLTLYGLRGPHKADSIQGTARTLSPVLESPRDLQFSEIRETSAKVNWMPPPSR
ADSFKVSYQLADGGEPQSVQVDGQARTQKLQGLIPGARYEVTVVSVRGFEESEPLTGFLT
TVPDGPTQLRALNLTEGFAVLHWKPPQNPVDTYDVQVTAPGAPPLQAETPGSAVDYPLHD
LVLHTNYTATVRGLRGPNLTSPASITFTTGLEAPRDLEAKEVTPRTALLTWTEPPVRPAG
YLLSFHTPGGQNQEILLPGGITSHQLLGLFPSTSYNARLQAMWGQSLLPPVSTSFTTGGL
RIPFPRDCGEEMQNGAGASRTSTIFLNGNRERPLNVFCDMETDGGGWLVFQRRMDGQTDF
WRDWEDYAHGFGNISGEFWLGNEALHSLTQAGDYSMRVDLRAGDEAVFAQYDSFHVDSAA
EYYRLHLEGYHGTAGDSMSYHSGSVFSARDRDPNSLLISCAVSYRGAWWYRNCHYANLNG
LYGSTVDHQGVSWYHWKGFEFSVPFTEMKLRPRNFRSPAGGG
NT seq 12729 nt NT seq  +upstreamnt  +downstreamnt
atgatgccagcccagtatgctctaacctccagcctggttctcctggtgctgctgagcaca
gccagagcaggccccttctcttcacggtccaatgtgacactgccagccccccggccccct
ccccagccagggggccacacagtgggggctggagtgggaagcccctcttctcagctttac
gagcacacagtggaaggaggggagaagcaggtggtattcacccaccgcattaacctgccc
ccttccactggctgtggctgtcccccaggcaccgagcccccagtccttgcttcagaggta
caggccctgagggtccgtctagagatcctggaggagttggtgaaggggctcaaggaacag
tgcactgggggatgttgtcctgcctctgcccaagctggcacaggtcagacagatgtgcgg
accctctgcagtctccatggtgtgtttgatctgagccgctgcacctgttcctgtgagcca
ggctggggtgggcccacctgctcagaccccacagatgctgagatccctccctcttcccca
ccctcagcctcggggtcctgcccagatgactgcaatgatcagggtcgctgtgtccgtggt
cgttgcgtgtgctttcccggctacactggccccagctgtggctggccatcctgtcccggg
gactgccaaggccgtgggcgctgcgtgcagggcgtgtgtgtgtgccgggcaggcttctca
ggccccgactgcagccagcgctcctgccctcgaggttgcagccagaggggacgctgtgag
ggtgggcgctgcgtgtgtgacccaggctacactggtgacgactgtggcatgaggagctgc
cctcgcggttgcagtcagagggggcgctgtgagaatgggcgctgcgtgtgtaaccccggc
tacactggcgaggactgtggggtgaggagctgccctcggggctgcagccagcggggacgc
tgcaaggacgggcgctgcgtgtgtgaccccggctacactggcgaggactgtggtacgcgg
agctgcccctgggactgtggcgagggcgggcgctgcgtggacggccgctgcgtgtgctgg
cccgggtacacaggcgaggactgcagcacgcggacatgtccgagggactgccggggccgc
gggcgctgcgaggacggcgaatgcatttgcgacacgggctacagcggggacgactgcggc
gtgcgcagctgccctggcgactgcaaccaaaggggccgctgcgaggacggccgctgcgtg
tgctggccggggtacactggaaccgattgcggctcgcgcgcctgcccacgcgactgtaga
ggtcgcgggcgctgcgagaacggcgtgtgtgtttgcaatgcgggctacagcggcgaggac
tgcggtgtgcgcagctgtcctggggactgtcgtggccggggccgctgtgagagtggccgc
tgcatgtgttggccggggtacacaggccgggactgcggcacgcgcgcctgtcctggcgac
tgtcgcgggcgcgggcgctgcgtggatggccgctgcgtgtgcaacccgggcttcaccggt
gaggactgtgggagccgtcgctgtcccggggactgccgtgggcacggcctttgcgaggat
ggcgtgtgcgtgtgtgacgcaggctactcaggggaagactgcagcacgcgcagctgcccc
gggggctgccgaggccgcggccagtgcctagatgggcggtgtgtgtgcgaggacggctac
tctggcgaggattgcggtgtgaggcagtgcccgaatgactgcagccagcacggcgtgtgc
caggacggtgtgtgcatctgttgggaaggctacgtgagtgaggactgcagcatccgcacc
tgcccctccaactgccacgggaggggccgctgtgaggaagggcgctgcctgtgcgaccca
ggctacaccggccctacctgtgccacccgcatgtgcccggctgactgccggggacgtggg
cggtgtgtgcaaggagtgtgcctgtgccacgtgggctatggcggtgaggactgcgggcag
gaagagcctccagccagcgcctgccctggaggctgcgggccccgggaactgtgccgggca
ggccagtgtgtgtgtgtagagggcttccgaggccctgactgtgccatccagacatgccca
ggggactgccgtggccgaggagagtgtcacgatggcagctgtgtctgcaaagatgggtat
gctggcgaagactgcggagaagaggtgccaaccattgagggcatgaggatgcatctcttg
gaggagacaacagttcggacagagtggaccccggctcctggccccgtggatgcctatgaa
attcagttcatccccacgacagagggggcgagccccccattcacagcacgggttccaagc
tctgcctcagcctatgaccagagaggactggcccctggacaggagtaccaggtcactgtc
cgagcccttcgagggaccagctggggccttcctgcctccaagaccatcaccaccatgatc
gatgggccccaggacctccgagtggtggctgtgacaccgacaacactggagcttggctgg
ctgcgtccccaggctgaggtggaccgatttgtggtgtcctacgtcagtgccggcaaccag
agggtgaggctggaagtgccccctgaagcagacgggacgctgctgactgacctgatgcca
ggcgtagaatatgtggtgactgtcacagcggagcggggccgggcagtcagctacccagct
tctgtcagggccaacacagggtcctcacccttgggcctcttggggactaccgatgagcct
cctccctcaggcccctcgacgacgcaaggggcccaggctcctctcctgcagcagcgcccc
caggagctgggagagttgagggtgctgggcagagatgagacagggcgcctccgtgtggtc
tggaccgcccagcctgacacctttgcctacttccaactgcgcatgcgggtgcccgagggg
ccgggggcacatgaggaagtgctgccaggggacgtccgccaggctctggtgcctccaccc
cctcctggaaccccgtatgagctgtcacttcatggggtccctcctgggggcaagccctct
gaccccatcatctaccaaggcattatggacaaggatgaggagaagcctgggaagtcctca
ggcccaccacgcctgggtgagctgacggtgacagacaggacctccgactccttgctcctg
cgctggacggtccccgagggcgagtttgactccttcgtgatccagtacaaagacagggac
gggcagccccaggtggtgcccgtggaaggaccccagcgctcggccgtcatcacctccctg
gatcctggccgcaagtacaaatttgtcctgtatgggtttgttggcaagaagaggcatggt
ccgctggtggctgaagccaagatcttgcctcagagtgacccaagtccagggactccaccc
cacctgggaaacctgtgggtgacagaccctaccccagattcactgcacctctcctggact
gtccctgagggccagtttgacaccttcatggtccagtacagggacagggatggacggccc
caggtggtacctgtggaagggcccgagcgttcatttgttgtctcctcactggaccctgac
cacaagtacagattcactctgtttggaattgcgaacaagaagcggtatggccccctcacg
gccgatggcaccactgctccagagaggaaagaggagcccccccgccctgagttcctggag
cagcccctcctgggggaactgacagtgaccggcgtgaccccagactccttgcgtctctca
tggacagtggcccagggccccttcgactcattcatggtccagtacaaggatgcacagggg
cagccccaggcagtgcctgttgcgggggatgagaatgaggttactgtccccggcctggat
cccgaccggaagtataagatgaacctctacgggcttcgtggcaggcagcgtgtggggccc
gagtctgtggtggccaagactgctcctcaggaggatgtggacgagacccccagccccaca
gaactgggcacggaggccccggagtcccccgaggagccgctcctgggggagctgacagtg
acaggatcctcccctgattcgctgagcctcttctggaccgtcccccagggcagcttcgac
tctttcaccgtgcagtacaaggacagggatgggcggccccgggcggtgcgtgttgggggc
aaggagagtgaggtcaccgtgggaggcctagagcccgggcacaagtacaagatgcacctg
tacggcctccacgaggggcagcgcgtgggcccggtgtccgccgtgggcgtgacagcccca
caacaagaagagacccctccagccactgagtccccgctggagccacgcctaggagagctg
acagtgacagatgtgacccccaactctgtgggcctctcctggacagtccccgagggccag
tttgactccttcatagtccagtacaaggacaaggacgggcagccccaggtggtgccggtg
gcggcagaccagcgagaggtcacagtctacaacctggagcctgagagaaaatataagatg
aacatgtatggactacatgatgggcaacgcatgggccccctgtctgtggtcatcgtgacg
gctcccctcccaccagccccagccacagaggcctccaagcctcccctggagccacgccta
ggggagctgacagtgacggatataacccctgactctgtgggcctctcatggacagtccct
gagggtgaattcgactcctttgtggttcagtacaaggacagggacgggcagccccaggtg
gtgcccgtggctgcagatcagcgggaggtcactatccctgacctggaaccctcccgcaag
tacaagttcctgctctttgggatccaggatgggaaacgacgcagcccagtctctgtggag
gcaaagacggttgcccgaggtgacgccagcccaggggccccaccccgccttggggagctg
tgggtgacagaccccaccccagactcactgcgcctctcctggacggttcctgagggccag
ttcgactcttttgtggtccagttcaaggacaaagacgggccccaggtggtgcccgtggag
ggccatgagcgctctgtcactgtcacccctctggatgccggccgcaagtacagattcctc
ctctatggcctcctgggcaagaagcgccatggccctctcactgccgacggcaccacggaa
gcccggagtgctatggatgatactggaacaaagcgtcccccaaaaccccgtctgggggag
gagctgcaggtgaccaccgtgacccagaactccgtgggcctctcctggacagtccctgag
ggccagtttgactcctttgtggtccagtacaaagacagggacgggcagccccaggtggtg
cccgtggagggcagcctcagggaggtcagcgtgccgggcctggaccctgcccacaggtac
aagctgctgctctacgggctgcaccacggcaagcgtgtgggccccatctcggccgtcgcc
attactgccggcagggaagaaacggaaactgagaccacggccccgacccctccagcgcct
gagccccacctcggggagttgacagtggaggaggccacgtcacacaccctgcatctctcc
tggatggtgactgagggagaatttgactccttcgaaatccagtacacagatagagacggg
caactccaaatggtccgcataggaggtgaccggaatgacatcaccctctctggcctggaa
tccgaccacagatacctggtgaccctgtatggtttcagtgatgggaagcatgtaggtcct
gtccatgtcgaggccctgacagtcccggaggaggagaagccttcagaacctcccaccgca
acccccgagccccccatcaagcctcgcctgggggagctgaccgtgacagatgccacccct
gactccctcagcctgtcctggacagttcccgagggacagtttgaccacttcctggtccag
tacaggaatggagatgggcagcccaaggcagtgagggtgccagggcacgaggaaggggtc
accatctcgggcctggagccagaccataaatacaagatgaacctgtacggcttccacggt
ggccagcgcatgggccctgtgtctgtcgtcggggtgacagctgcagaggaagagaccccc
agccccacagaacccagcatggaggccccggagcccgctgaggagccgctcctgggggag
ctaacagtgacaggatcctcccctgactcgctgagcctctcctggaccgtcccccagggc
cgcttcgactccttcaccgtgcagtacaaggacagggacgggcggccccaggtggtgcgt
gttgggggcgaggagagtgaagtcaccgtggggggcctggagcctgggcgcaagtacaag
atgcacctgtacggcctccacgaggggcggcgcgtgggcccagtgtctgctgtgggcgtc
acggcccccgaagaggagtcccctgatgctcctcttgcaaagctgcgcctagggcagatg
acagtgagagacatcacctccgactccctcagcctctcctggacagtccccgagggccag
tttgaccatttcttggtccagtttaagaatggggacgggcagcccaaggcggtgcgggtg
ccgggacacgaggatggggtcaccatctcgggcctggagccagaccacaagtacaagatg
aacctgtacggcttccacggtggccagcgcgtgggccccgtgtctgctgttggtttaact
gccccaggaaaggatgaagaaatggccccagcctcgacagaacctcccacccctgaaccc
cccatcaagcctcgcctggaggagctgaccgtgacagatgcgacccctgactccctcagc
ctgtcctggacggttcccgagggacagtttgaccacttcctggtccagtacaagaatggg
gatgggcagcccaaggcaacacgggtgccaggacatgaggacagggtcaccatctccggc
ctggagccagacaacaagtacaagatgaacctgtacggcttccacggtggccagcgtgtg
ggccccgtgtctgccatcggggtgacagctgcagaggaagagacccccagccccacagaa
cccagcatggaggccccggagccccctgaggagccgctcctgggggagctaacagtgaca
ggatcctcccctgactcgctgagcctctcctggaccgtcccccagggccgcttcgactcc
ttcaccgtgcagtacaaggacagggacgggcggccccaggtggtgcgtgttgggggcgag
gagagcgaggtcaccgtggggggcctggagcctgggcgcaaatacaagatgcacctgtat
ggcctccacgaggggcggcgcgtgggcccggtgtccaccgtgggcgtgactgccccacaa
gaggatgtggacgagacccccagccctacagaaccaggcacagaggccccagggcccccc
gaggagcctctcctgggggagctgacagtgacaggatcctcccctgactcgctgagcctt
tcctggaccgtcccccagggccgctttgactccttcaccgtgcagtacaaggacagggac
gggcggccccaggcggtgcgtgttgggggccaggagagcaaggtcactgtgaggggcctg
gagcctgggcgcaagtacaagatgcacctgtacggcctccacgaggggcggcgcctgggc
ccggtgtctgccgtgggcgtcacagaggatgaagccgagaccacccaagcagtgcctacc
atgacccctgagccccccatcaagcctcgcctgggggagctgaccatgacagatgccacc
cctgactccctcagcctgtcctggacggttcccgagggccagtttgaccacttcctggtc
cagtacaggaatggggatgggcagcccaaggcggtgcgggtgccggggcacgaggacggg
gtcaccatctcaggcctggagccagaccataaatacaagatgaacctgtacggcttccac
ggtggccagcgcgtgggccccatctctgtcattggggtgacggctgcagaggaagagacc
cccagccccacggaactcagcactgaggccccggagccccctgaggagccgctcctgggg
gagctgacagtgacaggatcctcccctgactcgctgagcctctcctggaccatcccccag
ggccacttcgactccttcaccgtgcagtacaaggacagggacgggcggccccaggtgatg
cgtgtcaggggcgaggagagcgaggtcaccgtggggggcctggagcccgggcgcaaatac
aagatgcacctgtacggcctccacgaggggcggcgtgtgggcccggtgtccaccgtgggt
gtgacagaggatgaagcagagaccacccaagcagtgcccaccacaacccctgagcccccc
aacaagcctcgcctcggggagctgaccgtgacagatgccacccctgactccctcagcctg
tcctggatggtccccgagggccagtttgaccacttcctggtccagtacaggaatggggat
gggcagcccaaggtggtgcgggtgccggggcacgaggacggggtcaccatctcaggcctg
gagccagaccacaagtacaagatgaacctgtacggcttccacggtggccagcgcgtgggc
cccatctctgtcattggggtgacagctgcagaggaagaaactcccgcccccacagaaccc
agcacggaggccccggagccccctgaggagccgctcctgggggagctgacagtgacagga
tcctcccctgactcgctgagcctctcctggaccatcccccagggccgcttcgactccttc
actgtgcagtacaaggacagggacgggcggccccaggtggtgcgtgtcaggggcgaggag
agcgaggtcaccgtggggggcctggagcccgggtgcaaatacaagatgcacctgtacggc
ctccacgaggggcagcgcgtgggcccagtgtccgctgtgggtgtgacagctccaaaggat
gaagccgagaccacccaagcagtgcctaccatgacccctgagccccccatcaagcctcgc
ctgggggagctgaccgtgacagatgccacccccgactccctcagcctgtcctggatggtt
cccgagggccagtttgaccacttcctggtccagtacaggaatggggatgggcagcccaag
gcggtgcgggtgccggggcacgaggacggggtcaccatctcaggcctggagccagaccat
aaatacaagatgaacctgtacggcttccacggtggccagcgcgtaggccctgtgtctgcc
attggggtgacggaggaagagacccccagccccacagaacccagcactgaggccccggag
gcccctgaggagccgctcctgggggagttgacagtgacaggatcctcccctgactcgctg
agcctctcctggaccgtcccccagggccgcttcgactccttcaccgtgcagtacaaggac
agggacgggcagccccaggtggtgcgtgtcaggggcgaggagagcgaggtcaccgtgggg
ggcctggagcccgggcgcaaatacaagatgcatctgtacggcctccacgaggggcagcgc
gtgggcccagtgtccaccgtgggcatcacggcgcccctgcccacaccactgccggtggag
ccccgcctgggggagctggcggtggcggccgtgacctcggactcagtgggcctctcatgg
acggtggcccagggcccctttgactccttcctggtacagtacagggacgcgcaggggcag
ccccaggcagtgcctgtgagcggagacctccgagcggtcgccgtctcggggctggacccg
gcccgcaagtacaagttcctgctctttggactccagaatgggaaacgccacggcccagtc
cctgtggaggccaggaccgccccagacaccaaaccgtctccccgcctgggggagctgact
gtgacagatgcgacccctgactccgtgggcctctcgtggacggtccctgagggcgaattc
gactccttcgtggtccagtacaaggataaggatggtcggctccaggtggtgccggtggca
gccaaccagcgggaggtcacagtccagggcctggagcccagtaggaaatacaggttcctg
ctctatggtctgtcaggcaggaaacgactgggccccatctctgctgacagcaccacagct
cccctggagaaggagctacctccccacctgggggaactgaccgtggctgaggagacctcc
agctctctgcgcctgtcctggacggtagcccagggcccctttgactccttcgtggtccag
tacagggacacggacgggcagcccagggcagtgcctgtggccgcagaccagcgcacagtc
accgtagaggacctggagcctggcaagaaatacaagtttctgctctacgggctccttggg
ggaaagcgcctgggcccggtctctgccctgggaatgacagccccagaagaggacacacca
gccccagagttagccccagaggcccctgagcctcctgaagagccccgcctaggagtgctg
accgtgaccgacacaaccccagactccatgcgcctctcgtggagcgtggcccagggcccc
tttgattccttcgtggtccagtatgaggacacgaacgggcagccccaggccttgctcgtg
gacggcgaccagagcaagatcctcatctcaggcctggagcccagcaccccctacaggttc
ctcctctatggcctccatgaagggaagcgcctggggcccctctcagctgagggcaccaca
gggctggctcctgctggtcagacctcagaggagtcaaggccccgcctgtcccagctgtct
gtgactgacgtgaccaccagttcactgaggctcaactgggaggccccaccgggggccttc
gactccttcctgctccgctttggggttccatcaccaagcactctggagccgcatccgcgt
ccactgctgcagcgcgagctgatggtgccggggacgcggcactcggccgtgctccgggac
ctgcgttccgggactctgtacagcctgacactgtatgggctgcgaggaccccacaaggcc
gacagcatccagggaaccgcccgcaccctcagcccagttctggagagcccccgtgacctc
caattcagtgaaatcagggagacctcagccaaggtcaactggatgcccccaccatcccgg
gcggacagcttcaaagtctcctaccagctggcggacggaggggagcctcagagtgtgcag
gtggatggccaggcccggacccagaaactccaggggctgatcccaggcgctcgctatgag
gtgaccgtggtctcggtccgaggctttgaggagagtgagcctctcacaggcttcctcacc
acggttcctgacggtcccacacagttgcgtgcactgaacttgaccgagggattcgccgtg
ctgcactggaagcccccccagaatcctgtggacacctatgacgtccaggtcacagcccct
ggggccccgcctctgcaggcggagaccccaggcagcgcggtggactaccccctgcatgac
cttgtcctccacaccaactacaccgccacagtgcgtggcctgcggggccccaacctcact
tccccagccagcatcaccttcaccacagggctagaggcccctcgggacttggaggccaag
gaagtgaccccccgcaccgccctgctcacttggactgagcccccagtccggcccgcaggc
tacctgctcagcttccacacccctggtggacagaaccaggagatcctgctcccaggaggg
atcacatctcaccagctccttggcctctttccctccacctcctacaatgcacggctccag
gccatgtggggccagagcctcctgccgcccgtgtccacctctttcaccacgggtgggctg
cggatccccttccccagggactgcggggaggagatgcagaacggagccggtgcctccagg
accagcaccatcttcctcaacggcaaccgcgagcggcccctgaacgtgttttgcgacatg
gagactgatgggggcggctggctggtgttccagcgccgcatggatggacagacagacttc
tggagggactgggaggactatgcccatggttttgggaacatctctggagagttctggctg
ggcaatgaggccctgcacagcctgacacaggcaggtgactactccatgcgcgtggacctg
cgggctggggacgaggctgtgttcgcccagtacgactccttccacgtagactcggctgcg
gagtactaccgcctccacttggagggctaccacggcaccgcaggggactccatgagctac
cacagcggcagtgtcttctctgcccgtgatcgggaccccaacagcttgctcatctcctgc
gctgtctcctaccgaggggcctggtggtacaggaactgccactacgccaacctcaacggg
ctctacgggagcacagtggaccatcagggagtgagctggtaccactggaagggcttcgag
ttctcggtgcccttcacggaaatgaagctgagaccaagaaactttcgctccccagcgggg
ggaggctga

DBGET integrated database retrieval system