KEGG   Homo sapiens (human): 715Help
Entry
715               CDS       T01001                                 

Gene name
C1R
Definition
complement component 1, r subcomponent (EC:3.4.21.41)
Orthology
K01330  
complement component 1, r subcomponent [EC:3.4.21.41]
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Complement and coagulation cascades
Pertussis
Staphylococcus aureus infection
Systemic lupus erythematosus
Disease
H00102  
Classic complement pathway component defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    715 (C1R)
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    715 (C1R)
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    715 (C1R)
  Infectious diseases
   05133 Pertussis
    715 (C1R)
   05150 Staphylococcus aureus infection
    715 (C1R)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.41  complement subcomponent C_overbar_1r_
     715 (C1R)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   715 (C1R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
12p13
AA seq 705 aa AA seqDB search
MWLLYLLVPALFCRAGGSIPIPQKLFGEVTSPLFPKPYPNNFETTTVITVPTGYRVKLVF
QQFDLEPSEGCFYDYVKISADKKSLGRFCGQLGSPLGNPPGKKEFMSQGNKMLLTFHTDF
SNEENGTIMFYKGFLAYYQAVDLDECASRSKLGEEDPQPQCQHLCHNYVGGYFCSCRPGY
ELQEDRHSCQAECSSELYTEASGYISSLEYPRSYPPDLRCNYSIRVERGLTLHLKFLEPF
DIDDHQQVHCPYDQLQIYANGKNIGEFCGKQRPPDLDTSSNAVDLLFFTDESGDSRGWKL
RYTTEIIKCPQPKTLDEFTIIQNLQPQYQFRDYFIATCKQGYQLIEGNQVLHSFTAVCQD
DGTWHRAMPRCKIKDCGQPRNLPNGDFRYTTTMGVNTYKARIQYYCHEPYYKMQTRAGSR
ESEQGVYTCTAQGIWKNEQKGEKIPRCLPVCGKPVNPVEQRQRIIGGQKAKMGNFPWQVF
TNIHGRGGGALLGDRWILTAAHTLYPKEHEAQSNASLDVFLGHTNVEELMKLGNHPIRRV
SVHPDYRQDESYNFEGDIALLELENSVTLGPNLLPICLPDNDTFYDLGLMGYVSGFGVME
EKIAHDLRFVRLPVANPQACENWLRGKNRMDVFSQNMFCAGHPSLKQDACQGDSGGVFAV
RDPNTDRWVATGIVSWGIGCSRGYGFYTKVLNYVDWIKKEMEEED
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgtggctcttgtacctcctggtgccggccctgttctgcagggcaggaggctccattccc
atccctcagaagttatttggggaggtgacttcccctctgttccccaagccttaccccaac
aactttgaaacaaccactgtgatcacagtccccacgggatacagggtgaagctcgtcttc
cagcagtttgacctggagccttctgaaggctgcttctatgattatgtcaagatctctgct
gataagaaaagcctggggaggttctgtgggcaactgggttctccactgggcaaccccccg
ggaaagaaggaatttatgtcccaagggaacaagatgctgctgaccttccacacagacttc
tccaacgaggagaatgggaccatcatgttctacaagggcttcctggcctactaccaagct
gtggaccttgatgaatgtgcttcccggagcaaattaggggaggaggatccccagccccag
tgccagcacctgtgtcacaactacgttggaggctacttctgttcctgccgtccaggctat
gagcttcaggaagacaggcattcctgccaggctgagtgcagcagcgagctgtacacggag
gcatcaggctacatctccagcctggagtaccctcggtcctacccccctgacctgcgctgc
aactacagcatccgggtggagcggggcctcaccctgcacctcaagttcctggagcctttt
gatattgatgaccaccagcaagtacactgcccctatgaccagctacagatctatgccaac
gggaagaacattggcgagttctgtgggaagcaaaggccccccgacctcgacaccagcagc
aatgctgtggatctgctgttcttcacagatgagtcgggggacagccggggctggaagctg
cgctacaccaccgagatcatcaagtgcccccagcccaagaccctagacgagttcaccatc
atccagaacctgcagcctcagtaccagttccgtgactacttcattgctacctgcaagcaa
ggctaccagctcatagaggggaaccaggtgctgcattccttcacagctgtctgccaggat
gatggcacgtggcatcgtgccatgcccagatgcaagatcaaggactgtgggcagccccga
aacctgcctaatggtgacttccgttacaccaccacaatgggagtgaacacctacaaggcc
cgtatccagtactactgccatgagccatattacaagatgcagaccagagctggcagcagg
gagtctgagcaaggggtgtacacctgcacagcacagggcatttggaagaatgaacagaag
ggagagaagattcctcggtgcttgccagtgtgtgggaagcccgtgaaccccgtggaacag
aggcagcgcatcatcggagggcaaaaagccaagatgggcaacttcccctggcaggtgttc
accaacatccacgggcgcgggggcggggccctgctgggcgaccgctggatcctcacagct
gcccacaccctgtatcccaaggaacacgaagcgcaaagcaacgcctctttggatgtgttc
ctgggccacacaaatgtggaagagctcatgaagctaggaaatcaccccatccgcagggtc
agcgtccacccggactaccgtcaggatgagtcctacaattttgagggggacatcgccctg
ctggagctggaaaatagtgtcaccctgggtcccaacctcctccccatctgcctccctgac
aacgataccttctacgacctgggcttgatgggctatgtcagtggcttcggggtcatggag
gagaagattgctcatgacctcaggtttgtccgtctgcccgtagctaatccacaggcctgt
gagaactggctccggggaaagaataggatggatgtgttctctcaaaacatgttctgtgct
ggacacccatctctaaagcaggacgcctgccagggggatagtgggggcgtttttgcagta
agggacccgaacactgatcgctgggtggccacgggcatcgtgtcctggggcatcgggtgc
agcaggggctatggcttctacaccaaagtgctcaactacgtggactggatcaagaaagag
atggaggaggaggactga

DBGET integrated database retrieval system