KEGG   Homo sapiens (human): 7150Help
Entry
7150              CDS       T01001                                 

Gene name
TOP1, TOPI
Definition
(RefSeq) topoisomerase (DNA) I (EC:5.99.1.2)
  KO
K03163  
DNA topoisomerase I [EC:5.99.1.2]
Organism
hsa  Homo sapiens (human)
Drug target
Brite
Enzymes [BR:hsa01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.2  DNA topoisomerase
     7150 (TOP1)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Topoisomerases
   7150 (TOP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q12-q13.1
AA seq 765 aa AA seqDB search
MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHSNSEHKDSEKK
HKEKEKTKHKDGSSEKHKDKHKDRDKEKRKEEKVRASGDAKIKKEKENGFSSPPQIKDEP
EDDGYFVPPKEDIKPLKRPRDEDDADYKPKKIKTEDTKKEKKRKLEEEEDGKLKKPKNKD
KDKKVPEPDNKKKKPKKEEEQKWKWWEEERYPEGIKWKFLEHKGPVFAPPYEPLPENVKF
YYDGKVMKLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFKDWRKEMTNEEKNIITNLSKC
DFTQMSQYFKAQTEARKQMSKEEKLKIKEENEKLLKEYGFCIMDNHKERIANFKIEPPGL
FRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLVSWTENI
QGSIKYIMLNPSSRIKGEKDWQKYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVALY
FIDKLALRAGNEKEEGETADTVGCCSLRVEHINLHPELDGQEYVVEFDFLGKDSIRYYNK
VPVEKRVFKNLQLFMENKQPEDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYNASITLQQ
QLKELTAPDENIPAKILSYNRANRAVAILCNHQRAPPKTFEKSMMNLQTKIDAKKEQLAD
ARRDLKSAKADAKVMKDAKTKKVVESKKKAVQRLEEQLMKLEVQATDREENKQIALGTSK
LNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atgagtggggaccacctccacaacgattcccagatcgaagcggatttccgattgaatgat
tctcataaacacaaagataaacacaaagatcgagaacaccggcacaaagaacacaagaag
gagaaggaccgggaaaagtccaagcatagcaacagtgaacataaagattctgaaaagaaa
cacaaagagaaggagaagaccaaacacaaagatggaagctcagaaaagcataaagacaaa
cataaagacagagacaaggaaaaacgaaaagaggaaaaggttcgagcctctggggatgca
aaaataaagaaggagaaggaaaatggcttctctagtccaccacaaattaaagatgaacct
gaagatgatggctattttgttcctcctaaagaggatataaagccattaaagagacctcga
gatgaggatgatgctgattataaacctaagaaaattaaaacagaagataccaagaaggag
aagaaaagaaaactagaagaagaagaggatggtaaattgaaaaaacccaagaataaagat
aaagataaaaaagttcctgagccagataacaagaaaaagaagccgaagaaagaagaggaa
cagaagtggaaatggtgggaagaagagcgctatcctgaaggcatcaagtggaaattccta
gaacataaaggtccagtatttgccccaccatatgagcctcttccagagaatgtcaagttt
tattatgatggtaaagtcatgaagctgagccccaaagcagaggaagtagctacgttcttt
gcaaaaatgctcgaccatgaatatactaccaaggaaatatttaggaaaaatttctttaaa
gactggagaaaggaaatgactaatgaagagaagaatattatcaccaacctaagcaaatgt
gattttacccagatgagccagtatttcaaagcccagacggaagctcggaaacagatgagc
aaggaagagaaactgaaaatcaaagaggagaatgaaaaattactgaaagaatatggattc
tgtattatggataaccacaaagagaggattgctaacttcaagatagagcctcctggactt
ttccgtggccgcggcaaccaccccaagatgggcatgctgaagagacgaatcatgcccgag
gatataatcatcaactgtagcaaagatgccaaggttccttctcctcctccaggacataag
tggaaagaagtccggcatgataacaaggttacttggctggtttcctggacagagaacatc
caaggttccattaaatacatcatgcttaaccctagttcacgaatcaagggtgagaaggac
tggcagaaatacgagactgctcggcggctgaaaaaatgtgtggacaagatccggaaccag
tatcgagaagactggaagtccaaagagatgaaagtccggcagagagctgtagccctgtac
ttcatcgacaagcttgctctgagagcaggcaatgaaaaggaggaaggagaaacagcggac
actgtgggctgctgctcacttcgtgtggagcacatcaatctacacccagagttggatggt
caggaatatgtggtagagtttgacttcctcgggaaggactccatcagatactataacaag
gtccctgttgagaaacgagtttttaagaacctacaactatttatggagaacaagcagccc
gaggatgatctttttgatagactcaatactggtattctgaataagcatcttcaggatctc
atggagggcttgacagccaaggtattccgtacatacaatgcctccatcacgctacagcag
cagctaaaagaactgacagccccggatgagaacatcccagcgaagatcctttcttataac
cgtgccaatcgagctgttgcaattctttgtaaccatcagagggcaccaccaaaaactttt
gagaagtctatgatgaacttgcaaactaagattgatgccaagaaggaacagctagcagat
gcccggagagacctgaaaagtgctaaggctgatgccaaggtcatgaaggatgcaaagacg
aagaaggtagtagagtcaaagaagaaggctgttcagagactggaggaacagttgatgaag
ctggaagttcaagccacagaccgagaggaaaataaacagattgccctgggaacctccaaa
ctcaattatctggaccctaggatcacagtggcttggtgcaagaagtggggtgtcccaatt
gagaagatttacaacaaaacccagcgggagaagtttgcctgggccattgacatggctgat
gaagactatgagttttag

DBGET integrated database retrieval system