KEGG   Homo sapiens (human): 7156Help
Entry
7156              CDS       T01001                                 

Gene name
TOP3A, TOP3, ZGRF7
Definition
topoisomerase (DNA) III alpha (EC:5.99.1.2)
Orthology
K03165  
DNA topoisomerase III [EC:5.99.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
Homologous recombination
Fanconi anemia pathway
Module
Bloom's syndrome complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    7156 (TOP3A)
   03460 Fanconi anemia pathway
    7156 (TOP3A)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.2  DNA topoisomerase
     7156 (TOP3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17p12-p11.2
AA seq 1001 aa AA seqDB search
MIFPVARYALRWLRRPEDRAFSRAAMEMALRGVRKVLCVAEKNDAAKGIADLLSNGRMRR
REGLSKFNKIYEFDYHLYGQNVTMVMTSVSGHLLAHDFQMQFRKWQSCNPLVLFEAEIEK
YCPENFVDIKKTLERETRQCQALVIWTDCDREGENIGFEIIHVCKAVKPNLQVLRARFSE
ITPHAVRTACENLTEPDQRVSDAVDVRQELDLRIGAAFTRFQTLRLQRIFPEVLAEQLIS
YGSCQFPTLGFVVERFKAIQAFVPEIFHRIKVTHDHKDGIVEFNWKRHRLFNHTACLVLY
QLCVEDPMATVVEVRSKPKSKWRPQALDTVELEKLASRKLRINAKETMRIAEKLYTQGYI
SYPRTETNIFPRDLNLTVLVEQQTPDPRWGAFAQSILERGGPTPRNGNKSDQAHPPIHPT
KYTNNLQGDEQRLYEFIVRHFLACCSQDAQGQETTVEIDIAQERFVAHGLMILARNYLDV
YPYDHWSDKILPVYEQGSHFQPSTVEMVDGETSPPKLLTEADLIALMEKHGIGTDATHAE
HIETIKARMYVGLTPDKRFLPGHLGMGLVEGYDSMGYEMSKPDLRAELEADLKLICDGKK
DKFVVLRQQVQKYKQVFIEAVAKAKKLDEALAQYFGNGTELAQQEDIYPAMPEPIRKCPQ
CNKDMVLKTKKNGGFYLSCMGFPECRSAVWLPDSVLEASRDSSVCPVCQPHPVYRLKLKF
KRGSLPPTMPLEFVCCIGGCDDTLREILDLRFSGGPPRASQPSGRLQANQSLNRMDNSQH
PQPADSRQTGSSKALAQTLPPPTAAGESNSVTCNCGQEAVLLTVRKEGPNRGRQFFKCNG
GSCNFFLWADSPNPGAGGPPALAYRPLGASLGCPPGPGIHLGGFGNPGDGSGSGTSCLCS
QPSVTRTVQKDGPNKGRQFHTCAKPREQQCGFFQWVDENTAPGTSGAPSWTGDRGRTLES
EARSKRPRASSSDMGSTAKKPRKCSLCHQPGHTRPFCPQNR
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
atgatctttcctgtcgcccgctacgcgctccggtggctgcgacggcccgaagaccgtgcc
ttttcccgcgccgccatggagatggccctccgaggcgtgcggaaagtcctctgtgtggcc
gaaaaaaacgacgcggccaaggggatcgccgacctgctgtcaaacggtcgcatgaggcgg
agagaaggactttcaaaattcaacaagatctatgaatttgattatcatctgtatggccag
aatgttaccatggtaatgacttcagtttctggacatttactggctcatgatttccagatg
cagtttcgaaaatggcagagctgcaaccctcttgtcctctttgaagcagaaattgaaaag
tactgcccagagaattttgtagacatcaagaaaactttggaacgagagactcgccagtgc
caggctctggtgatctggactgactgtgatagagaaggcgaaaacatcgggtttgagatt
atccacgtgtgtaaggctgtaaagcccaatctgcaggtgttgcgagcccgattctctgag
atcacaccccatgccgtcaggacagcttgtgaaaacctgaccgagcctgatcagagggtg
agcgatgctgtggatgtgaggcaggagctggacctgaggattggagctgcctttactagg
ttccagaccctgcggcttcagaggatttttcctgaggtgctggcagagcagctcatcagt
tacggcagctgccagttccccacactgggctttgtggtggagcggttcaaagccattcag
gcttttgtaccagaaatcttccacagaattaaagtaactcatgaccacaaagatggtatc
gtagaattcaactggaaaaggcatcgactctttaaccacacggcttgcctagttctctat
cagttgtgtgtggaggatcccatggcaactgtggtagaggtcagatctaagcccaagagc
aagtggcggcctcaagccttggacactgtggagcttgagaagctggcttctcgaaagttg
agaataaatgctaaagaaaccatgaggattgctgagaagctctacactcaagggtacatc
agctatccccgaacagaaacaaacatttttcccagagacttaaacctgacggtgttggtg
gaacagcagacccccgatccacgctggggggcctttgcccagagcattctagagcggggt
ggtcccaccccacgcaatgggaacaagtctgaccaagctcaccctcccattcaccccacc
aaatacaccaacaacttacagggagatgaacagcgactgtacgagtttattgttcgccat
ttcctggcttgctgctcccaggatgctcaggggcaggagaccacagtggagatcgacatc
gctcaggaacgctttgtggcccatggcctcatgattctggcccgaaactatctggatgtg
tatccatatgatcactggagtgacaagatcctccctgtctatgagcaaggatcccacttt
cagcccagcaccgtggagatggtggacggggagaccagcccacccaagctgctcaccgag
gccgacctcattgccctcatggagaagcatggcattggtacggatgccactcatgcggag
cacatcgagaccatcaaagcccggatgtacgtgggcctcaccccagacaagcggttcctc
cctgggcacctgggcatgggacttgtggaaggttatgattccatgggctatgaaatgtct
aagcctgacctccgggctgaactggaagctgatctgaagctgatctgtgatggcaaaaag
gacaaatttgtggttctaaggcagcaagtgcagaaatacaagcaggttttcattgaagcg
gtggctaaagcaaagaaattggacgaggccttggcccagtactttgggaatgggacagag
ttggcccagcaagaagatatctacccagccatgccagagcccatcaggaagtgcccacag
tgcaacaaggacatggtccttaagaccaagaagaatggcgggttctacctcagctgcatg
ggtttcccagagtgtcgctcagctgtgtggcttcctgactcggtgctggaggccagcagg
gacagcagtgtgtgtccagtttgtcagccacaccctgtgtacaggttaaagttaaagttt
aagcgcggtagccttcccccgaccatgcctctggagtttgtttgctgcatcggcggatgc
gacgacaccctgagggagatcctggacctgagattttcagggggcccccccagggctagc
cagccctctggccgcctgcaggctaaccagtccctgaacaggatggacaacagccagcac
ccccagcctgctgacagcagacagactgggtcctcaaaggctctggcccagaccctccca
ccacccacggctgctggtgaaagcaattctgtgacctgcaactgtggccaggaggctgtg
ctgctcactgtccgtaaggagggccccaaccggggccggcagttctttaagtgcaacgga
ggtagctgcaacttcttcctgtgggcagacagccccaatccgggagcaggagggcctcct
gccttggcatatagacccctgggcgcctccctgggatgcccaccaggcccagggatccac
ctaggtgggtttggcaaccctggtgatggcagtggtagtggcacatcctgcctttgcagc
cagccctccgtcacacggactgtgcagaaggatggacccaacaaggggcgccagttccac
acatgtgccaagccgagagagcagcagtgtggctttttccagtgggtcgatgagaacacc
gctccagggacttctggagccccgtcctggacaggagacagaggaagaaccctggagtcg
gaagccagaagcaaaaggccccgggccagttcctcagacatggggtccacagcaaagaaa
ccccggaaatgcagcctttgccaccagcctggacacacccgtcccttttgtcctcagaac
agatga

DBGET integrated database retrieval system