KEGG   Homo sapiens (human): 7156Help
Entry
7156              CDS       T01001                                 

Gene name
TOP3A, TOP3, ZGRF7
Definition
(RefSeq) topoisomerase (DNA) III alpha (EC:5.99.1.2)
  KO
K03165  
DNA topoisomerase III [EC:5.99.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
Homologous recombination
Fanconi anemia pathway
Module
Bloom's syndrome complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    7156 (TOP3A)
   03460 Fanconi anemia pathway
    7156 (TOP3A)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.2  DNA topoisomerase
     7156 (TOP3A)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Topoisomerases
   7156 (TOP3A)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Bloom's syndrome complex (BTR)
     7156 (TOP3A)
   FA (Fanconi anemia) pathway
     7156 (TOP3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17p11.2
AA seq 1001 aa AA seqDB search
MIFPVARYALRWLRRPEDRAFSRAAMEMALRGVRKVLCVAEKNDAAKGIADLLSNGRMRR
REGLSKFNKIYEFDYHLYGQNVTMVMTSVSGHLLAHDFQMQFRKWQSCNPLVLFEAEIEK
YCPENFVDIKKTLERETRQCQALVIWTDCDREGENIGFEIIHVCKAVKPNLQVLRARFSE
ITPHAVRTACENLTEPDQRVSDAVDVRQELDLRIGAAFTRFQTLRLQRIFPEVLAEQLIS
YGSCQFPTLGFVVERFKAIQAFVPEIFHRIKVTHDHKDGIVEFNWKRHRLFNHTACLVLY
QLCVEDPMATVVEVRSKPKSKWRPQALDTVELEKLASRKLRINAKETMRIAEKLYTQGYI
SYPRTETNIFPRDLNLTVLVEQQTPDPRWGAFAQSILERGGPTPRNGNKSDQAHPPIHPT
KYTNNLQGDEQRLYEFIVRHFLACCSQDAQGQETTVEIDIAQERFVAHGLMILARNYLDV
YPYDHWSDKILPVYEQGSHFQPSTVEMVDGETSPPKLLTEADLIALMEKHGIGTDATHAE
HIETIKARMYVGLTPDKRFLPGHLGMGLVEGYDSMGYEMSKPDLRAELEADLKLICDGKK
DKFVVLRQQVQKYKQVFIEAVAKAKKLDEALAQYFGNGTELAQQEDIYPAMPEPIRKCPQ
CNKDMVLKTKKNGGFYLSCMGFPECRSAVWLPDSVLEASRDSSVCPVCQPHPVYRLKLKF
KRGSLPPTMPLEFVCCIGGCDDTLREILDLRFSGGPPRASQPSGRLQANQSLNRMDNSQH
PQPADSRQTGSSKALAQTLPPPTAAGESNSVTCNCGQEAVLLTVRKEGPNRGRQFFKCNG
GSCNFFLWADSPNPGAGGPPALAYRPLGASLGCPPGPGIHLGGFGNPGDGSGSGTSCLCS
QPSVTRTVQKDGPNKGRQFHTCAKPREQQCGFFQWVDENTAPGTSGAPSWTGDRGRTLES
EARSKRPRASSSDMGSTAKKPRKCSLCHQPGHTRPFCPQNR
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
atgatctttcctgtcgcccgctacgcgctccggtggctgcgacggcccgaagaccgtgcc
ttttcccgcgccgccatggagatggccctccgaggcgtgcggaaagtcctctgtgtggcc
gaaaaaaacgacgcggccaaggggatcgccgacctgctgtcaaacggtcgcatgaggcgg
agagaaggactttcaaaattcaacaagatctatgaatttgattatcatctgtatggccag
aatgttaccatggtaatgacttcagtttctggacatttactggctcatgatttccagatg
cagtttcgaaaatggcagagctgcaaccctcttgtcctctttgaagcagaaattgaaaag
tactgcccagagaattttgtagacatcaagaaaactttggaacgagagactcgccagtgc
caggctctggtgatctggactgactgtgatagagaaggcgaaaacatcgggtttgagatt
atccacgtgtgtaaggctgtaaagcccaatctgcaggtgttgcgagcccgattctctgag
atcacaccccatgccgtcaggacagcttgtgaaaacctgaccgagcctgatcagagggtg
agcgatgctgtggatgtgaggcaggagctggacctgaggattggagctgcctttactagg
ttccagaccctgcggcttcagaggatttttcctgaggtgctggcagagcagctcatcagt
tacggcagctgccagttccccacactgggctttgtggtggagcggttcaaagccattcag
gcttttgtaccagaaatcttccacagaattaaagtaactcatgaccacaaagatggtatc
gtagaattcaactggaaaaggcatcgactctttaaccacacggcttgcctagttctctat
cagttgtgtgtggaggatcccatggcaactgtggtagaggtcagatctaagcccaagagc
aagtggcggcctcaagccttggacactgtggagcttgagaagctggcttctcgaaagttg
agaataaatgctaaagaaaccatgaggattgctgagaagctctacactcaagggtacatc
agctatccccgaacagaaacaaacatttttcccagagacttaaacctgacggtgttggtg
gaacagcagacccccgatccacgctggggggcctttgcccagagcattctagagcggggt
ggtcccaccccacgcaatgggaacaagtctgaccaagctcaccctcccattcaccccacc
aaatacaccaacaacttacagggagatgaacagcgactgtacgagtttattgttcgccat
ttcctggcttgctgctcccaggatgctcaggggcaggagaccacagtggagatcgacatc
gctcaggaacgctttgtggcccatggcctcatgattctggcccgaaactatctggatgtg
tatccatatgatcactggagtgacaagatcctccctgtctatgagcaaggatcccacttt
cagcccagcaccgtggagatggtggacggggagaccagcccacccaagctgctcaccgag
gccgacctcattgccctcatggagaagcatggcattggtacggatgccactcatgcggag
cacatcgagaccatcaaagcccggatgtacgtgggcctcaccccagacaagcggttcctc
cctgggcacctgggcatgggacttgtggaaggttatgattccatgggctatgaaatgtct
aagcctgacctccgggctgaactggaagctgatctgaagctgatctgtgatggcaaaaag
gacaaatttgtggttctaaggcagcaagtgcagaaatacaagcaggttttcattgaagcg
gtggctaaagcaaagaaattggacgaggccttggcccagtactttgggaatgggacagag
ttggcccagcaagaagatatctacccagccatgccagagcccatcaggaagtgcccacag
tgcaacaaggacatggtccttaagaccaagaagaatggcgggttctacctcagctgcatg
ggtttcccagagtgtcgctcagctgtgtggcttcctgactcggtgctggaggccagcagg
gacagcagtgtgtgtccagtttgtcagccacaccctgtgtacaggttaaagttaaagttt
aagcgcggtagccttcccccgaccatgcctctggagtttgtttgctgcatcggcggatgc
gacgacaccctgagggagatcctggacctgagattttcagggggcccccccagggctagc
cagccctctggccgcctgcaggctaaccagtccctgaacaggatggacaacagccagcac
ccccagcctgctgacagcagacagactgggtcctcaaaggctctggcccagaccctccca
ccacccacggctgctggtgaaagcaattctgtgacctgcaactgtggccaggaggctgtg
ctgctcactgtccgtaaggagggccccaaccggggccggcagttctttaagtgcaacgga
ggtagctgcaacttcttcctgtgggcagacagccccaatccgggagcaggagggcctcct
gccttggcatatagacccctgggcgcctccctgggatgcccaccaggcccagggatccac
ctaggtgggtttggcaaccctggtgatggcagtggtagtggcacatcctgcctttgcagc
cagccctccgtcacacggactgtgcagaaggatggacccaacaaggggcgccagttccac
acatgtgccaagccgagagagcagcagtgtggctttttccagtgggtcgatgagaacacc
gctccagggacttctggagccccgtcctggacaggagacagaggaagaaccctggagtcg
gaagccagaagcaaaaggccccgggccagttcctcagacatggggtccacagcaaagaaa
ccccggaaatgcagcctttgccaccagcctggacacacccgtcccttttgtcctcagaac
agatga

DBGET integrated database retrieval system