KEGG   Homo sapiens (human): 716Help
Entry
716               CDS       T01001                                 

Gene name
C1S
Definition
complement component 1, s subcomponent (EC:3.4.21.42)
Orthology
K01331  
complement component 1, s subcomponent [EC:3.4.21.42]
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Pertussis
Staphylococcus aureus infection
Systemic lupus erythematosus
Disease
H00102  
Classic complement pathway component defects
Class
Organismal Systems; Immune system; Complement and coagulation cascades [PATH:hsa04610]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:hsa05322]
Human Diseases; Infectious diseases; Pertussis [PATH:hsa05133]
Human Diseases; Infectious diseases; Staphylococcus aureus infection [PATH:hsa05150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12p13
AA seq 688 aa AA seqDB search
MWCIVLFSLLAWVYAEPTMYGEILSPNYPQAYPSEVEKSWDIEVPEGYGIHLYFTHLDIE
LSENCAYDSVQIISGDTEEGRLCGQRSSNNPHSPIVEEFQVPYNKLQVIFKSDFSNEERF
TGFAAYYVATDINECTDFVDVPCSHFCNNFIGGYFCSCPPEYFLHDDMKNCGVNCSGDVF
TALIGEIASPNYPKPYPENSRCEYQIRLEKGFQVVVTLRREDFDVEAADSAGNCLDSLVF
VAGDRQFGPYCGHGFPGPLNIETKSNALDIIFQTDLTGQKKGWKLRYHGDPMPCPKEDTP
NSVWEPAKAKYVFRDVVQITCLDGFEVVEGRVGATSFYSTCQSNGKWSNSKLKCQPVDCG
IPESIENGKVEDPESTLFGSVIRYTCEEPYYYMENGGGGEYHCAGNGSWVNEVLGPELPK
CVPVCGVPREPFEEKQRIIGGSDADIKNFPWQVFFDNPWAGGALINEYWVLTAAHVVEGN
REPTMYVGSTSVQTSRLAKSKMLTPEHVFIHPGWKLLEVPEGRTNFDNDIALVRLKDPVK
MGPTVSPICLPGTSSDYNLMDGDLGLISGWGRTEKRDRAVRLKAARLPVAPLRKCKEVKV
EKPTADAEAYVFTPNMICAGGEKGMDSCKGDSGGAFAVQDPNDKTKFYAAGLVSWGPQCG
TYGLYTRVKNYVDWIMKTMQENSTPRED
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgtggtgcattgtcctgttttcacttttggcatgggtttatgctgagcctaccatgtat
ggggagatcctgtcccctaactatcctcaggcatatcccagtgaggtagagaaatcttgg
gacatagaagttcctgaagggtatgggattcacctctacttcacccatctggacattgag
ctgtcagagaactgtgcgtatgactcagtgcagataatctcaggagacactgaagaaggg
aggctctgtggacagaggagcagtaacaatccccactctccaattgtggaagagttccaa
gtcccatacaacaaactccaggtgatctttaagtcagacttttccaatgaagagcgtttt
acggggtttgctgcatactatgttgccacagacataaatgaatgcacagattttgtagat
gtcccttgtagccacttctgcaacaatttcattggtggttacttctgctcctgccccccg
gaatatttcctccatgatgacatgaagaattgcggagttaattgcagtggggatgtattc
actgcactgattggggagattgcaagtcccaattatcccaaaccatatccagagaactca
aggtgtgaataccagatccggttggagaaagggttccaagtggtggtgaccttgcggaga
gaagattttgatgtggaagcagctgactcagcgggaaactgccttgacagtttagttttt
gttgcaggagatcggcaatttggtccttactgtggtcatggattccctgggcctctaaat
attgaaaccaagagtaatgctcttgatatcatcttccaaactgatctaacagggcaaaaa
aagggctggaaacttcgctatcatggagatccaatgccctgccctaaggaagacactccc
aattctgtttgggagcctgcgaaggcaaaatatgtctttagagatgtggtgcagataacc
tgtctggatgggtttgaagttgtggagggacgtgttggtgcaacatctttctattcgact
tgtcaaagcaatggaaagtggagtaattccaaactgaaatgtcaacctgtggactgtggc
attcctgaatccattgagaatggtaaagttgaagacccagagagcactttgtttggttct
gtcatccgctacacttgtgaggagccatattactacatggaaaatggaggaggtggggag
tatcactgtgctggtaacgggagctgggtgaatgaggtgctgggcccggagctgccgaaa
tgtgttccagtctgtggagtccccagagaaccctttgaagaaaaacagaggataattgga
ggatccgatgcagatattaaaaacttcccctggcaagtcttctttgacaacccatgggct
ggtggagcgctcattaatgagtactgggtgctgacggctgctcatgttgtggagggaaac
agggagccaacaatgtatgttgggtccacctcagtgcagacctcacggctggcaaaatcc
aagatgctcactcctgagcatgtgtttattcatccgggatggaagctgctggaagtccca
gaaggacgaaccaattttgataatgacattgcactggtgcggctgaaagacccagtgaaa
atgggacccaccgtctctcccatctgcctaccaggcacctcttccgactacaacctcatg
gatggggacctgggactgatctcaggctggggccgaacagagaagagagatcgtgctgtt
cgcctcaaggcggcaaggttacctgtagctcctttaagaaaatgcaaagaagtgaaagtg
gagaaacccacagcagatgcagaggcctatgttttcactcctaacatgatctgtgctgga
ggagagaagggcatggatagctgtaaaggggacagtggtggggcctttgctgtacaggat
cccaatgacaagaccaaattctacgcagctggcctggtgtcctgggggccccagtgtggg
acctatgggctctacacacgggtaaagaactatgttgactggataatgaagactatgcag
gaaaatagcaccccccgtgaggactaa

DBGET integrated database retrieval system