KEGG   Homo sapiens (human): 716Help
Entry
716               CDS       T01001                                 

Gene name
C1S
Definition
complement component 1, s subcomponent (EC:3.4.21.42)
Orthology
K01331  
complement component 1, s subcomponent [EC:3.4.21.42]
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Pertussis
Staphylococcus aureus infection
Systemic lupus erythematosus
Disease
H00102  
Classic complement pathway component defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    716 (C1S)
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    716 (C1S)
  Infectious diseases
   05133 Pertussis
    716 (C1S)
   05150 Staphylococcus aureus infection
    716 (C1S)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.42  complement subcomponent C_overbar_1s_
     716 (C1S)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   716 (C1S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12p13
AA seq 688 aa AA seqDB search
MWCIVLFSLLAWVYAEPTMYGEILSPNYPQAYPSEVEKSWDIEVPEGYGIHLYFTHLDIE
LSENCAYDSVQIISGDTEEGRLCGQRSSNNPHSPIVEEFQVPYNKLQVIFKSDFSNEERF
TGFAAYYVATDINECTDFVDVPCSHFCNNFIGGYFCSCPPEYFLHDDMKNCGVNCSGDVF
TALIGEIASPNYPKPYPENSRCEYQIRLEKGFQVVVTLRREDFDVEAADSAGNCLDSLVF
VAGDRQFGPYCGHGFPGPLNIETKSNALDIIFQTDLTGQKKGWKLRYHGDPMPCPKEDTP
NSVWEPAKAKYVFRDVVQITCLDGFEVVEGRVGATSFYSTCQSNGKWSNSKLKCQPVDCG
IPESIENGKVEDPESTLFGSVIRYTCEEPYYYMENGGGGEYHCAGNGSWVNEVLGPELPK
CVPVCGVPREPFEEKQRIIGGSDADIKNFPWQVFFDNPWAGGALINEYWVLTAAHVVEGN
REPTMYVGSTSVQTSRLAKSKMLTPEHVFIHPGWKLLEVPEGRTNFDNDIALVRLKDPVK
MGPTVSPICLPGTSSDYNLMDGDLGLISGWGRTEKRDRAVRLKAARLPVAPLRKCKEVKV
EKPTADAEAYVFTPNMICAGGEKGMDSCKGDSGGAFAVQDPNDKTKFYAAGLVSWGPQCG
TYGLYTRVKNYVDWIMKTMQENSTPRED
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgtggtgcattgtcctgttttcacttttggcatgggtttatgctgagcctaccatgtat
ggggagatcctgtcccctaactatcctcaggcatatcccagtgaggtagagaaatcttgg
gacatagaagttcctgaagggtatgggattcacctctacttcacccatctggacattgag
ctgtcagagaactgtgcgtatgactcagtgcagataatctcaggagacactgaagaaggg
aggctctgtggacagaggagcagtaacaatccccactctccaattgtggaagagttccaa
gtcccatacaacaaactccaggtgatctttaagtcagacttttccaatgaagagcgtttt
acggggtttgctgcatactatgttgccacagacataaatgaatgcacagattttgtagat
gtcccttgtagccacttctgcaacaatttcattggtggttacttctgctcctgccccccg
gaatatttcctccatgatgacatgaagaattgcggagttaattgcagtggggatgtattc
actgcactgattggggagattgcaagtcccaattatcccaaaccatatccagagaactca
aggtgtgaataccagatccggttggagaaagggttccaagtggtggtgaccttgcggaga
gaagattttgatgtggaagcagctgactcagcgggaaactgccttgacagtttagttttt
gttgcaggagatcggcaatttggtccttactgtggtcatggattccctgggcctctaaat
attgaaaccaagagtaatgctcttgatatcatcttccaaactgatctaacagggcaaaaa
aagggctggaaacttcgctatcatggagatccaatgccctgccctaaggaagacactccc
aattctgtttgggagcctgcgaaggcaaaatatgtctttagagatgtggtgcagataacc
tgtctggatgggtttgaagttgtggagggacgtgttggtgcaacatctttctattcgact
tgtcaaagcaatggaaagtggagtaattccaaactgaaatgtcaacctgtggactgtggc
attcctgaatccattgagaatggtaaagttgaagacccagagagcactttgtttggttct
gtcatccgctacacttgtgaggagccatattactacatggaaaatggaggaggtggggag
tatcactgtgctggtaacgggagctgggtgaatgaggtgctgggcccggagctgccgaaa
tgtgttccagtctgtggagtccccagagaaccctttgaagaaaaacagaggataattgga
ggatccgatgcagatattaaaaacttcccctggcaagtcttctttgacaacccatgggct
ggtggagcgctcattaatgagtactgggtgctgacggctgctcatgttgtggagggaaac
agggagccaacaatgtatgttgggtccacctcagtgcagacctcacggctggcaaaatcc
aagatgctcactcctgagcatgtgtttattcatccgggatggaagctgctggaagtccca
gaaggacgaaccaattttgataatgacattgcactggtgcggctgaaagacccagtgaaa
atgggacccaccgtctctcccatctgcctaccaggcacctcttccgactacaacctcatg
gatggggacctgggactgatctcaggctggggccgaacagagaagagagatcgtgctgtt
cgcctcaaggcggcaaggttacctgtagctcctttaagaaaatgcaaagaagtgaaagtg
gagaaacccacagcagatgcagaggcctatgttttcactcctaacatgatctgtgctgga
ggagagaagggcatggatagctgtaaaggggacagtggtggggcctttgctgtacaggat
cccaatgacaagaccaaattctacgcagctggcctggtgtcctgggggccccagtgtggg
acctatgggctctacacacgggtaaagaactatgttgactggataatgaagactatgcag
gaaaatagcaccccccgtgaggactaa

DBGET integrated database retrieval system