KEGG   Homo sapiens (human): 7171Help
Entry
7171              CDS       T01001                                 

Gene name
TPM4, HEL-S-108
Definition
(RefSeq) tropomyosin 4
  KO
K10375  
tropomyosin 4
Organism
hsa  Homo sapiens (human)
Pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    7171 (TPM4)
   04261 Adrenergic signaling in cardiomyocytes
    7171 (TPM4)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    7171 (TPM4)
   05414 Dilated cardiomyopathy (DCM)
    7171 (TPM4)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     7171 (TPM4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.1
AA seq 248 aa AA seqDB search
MAGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLVE
EELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAE
EADRKYEEVARKLVILEGELERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSE
KEDKYEEEIKLLSDKLKEAETRAEFAERTVAKLEKTIDDLEEKLAQAKEENVGLHQTLDQ
TLNELNCI
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggccggcctcaactccctggaggcggtgaaacgcaagatccaggccctgcagcagcag
gcggacgaggcggaagaccgcgcgcagggcctgcagcgggagctggacggcgagcgcgag
cggcgcgagaaagctgaaggtgatgtggccgccctcaaccgacgcatccagctcgttgag
gaggagttggacagggctcaggaacgactggccacggccctgcagaagctggaggaggca
gaaaaagctgcagatgagagtgagagaggaatgaaggtgatagaaaaccgggccatgaag
gatgaggagaagatggagattcaggagatgcagctcaaagaggccaagcacattgcggaa
gaggctgaccgcaaatacgaggaggtagctcgtaagctggtcatcctggagggtgagctg
gagagggcagaggagcgtgcggaggtgtctgaactaaaatgtggtgacctggaagaagaa
ctcaagaatgttactaacaatctgaaatctctggaggctgcatctgaaaagtattctgaa
aaggaggacaaatatgaagaagaaattaaacttctgtctgacaaactgaaagaggctgag
acccgtgctgaatttgcagagagaacggttgcaaaactggaaaagacaattgatgacctg
gaagagaaacttgcccaggccaaagaagagaacgtgggcttacatcagacactggatcag
acactaaacgaacttaactgtatataa

DBGET integrated database retrieval system