KEGG   Homo sapiens (human): 7173Help
Entry
7173              CDS       T01001                                 

Gene name
TPO, MSA, TDH2A, TPX
Definition
thyroid peroxidase (EC:1.11.1.8)
Orthology
K00431  
thyroid peroxidase [EC:1.11.1.8]
Organism
hsa  Homo sapiens (human)
Pathway
Tyrosine metabolism
Metabolic pathways
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Hematopoietic cell lineage
Thyroid hormone synthesis
Autoimmune thyroid disease
Module
Thyroid hormone biosynthesis, tyrosine => triiodothyronine/thyroxine
Disease
H00251  
Thyroid dyshormonogenesis
Drug target
Methylthiouracil: 
Propylthiouracil: 
Benzylthiouracil: 
Thiamazole: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    7173 (TPO)
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    7173 (TPO)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7173 (TPO)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    7173 (TPO)
  Endocrine system
   04918 Thyroid hormone synthesis
    7173 (TPO)
 Human Diseases
  Immune diseases
   05320 Autoimmune thyroid disease
    7173 (TPO)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.8  iodide peroxidase
     7173 (TPO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p25
AA seq 933 aa AA seqDB search
MRALAVLSVTLVMACTEAFFPFISRGKELLWGKPEESRVSSVLEESKRLVDTAMYATMQR
NLKKRGILSPAQLLSFSKLPEPTSGVIARAAEIMETSIQAMKRKVNLKTQQSQHPTDALS
EDLLSIIANMSGCLPYMLPPKCPNTCLANKYRPITGACNNRDHPRWGASNTALARWLPPV
YEDGFSQPRGWNPGFLYNGFPLPPVREVTRHVIQVSNEVVTDDDRYSDLLMAWGQYIDHD
IAFTPQSTSKAAFGGGADCQMTCENQNPCFPIQLPEEARPAAGTACLPFYRSSAACGTGD
QGALFGNLSTANPRQQMNGLTSFLDASTVYGSSPALERQLRNWTSAEGLLRVHARLRDSG
RAYLPFVPPRAPAACAPEPGIPGETRGPCFLAGDGRASEVPSLTALHTLWLREHNRLAAA
LKALNAHWSADAVYQEARKVVGALHQIITLRDYIPRILGPEAFQQYVGPYEGYDSTANPT
VSNVFSTAAFRFGHATIHPLVRRLDASFQEHPDLPGLWLHQAFFSPWTLLRGGGLDPLIR
GLLARPAKLQVQDQLMNEELTERLFVLSNSSTLDLASINLQRGRDHGLPGYNEWREFCGL
PRLETPADLSTAIASRSVADKILDLYKHPDNIDVWLGGLAENFLPRARTGPLFACLIGKQ
MKALRDGDWFWWENSHVFTDAQRRELEKHSLSRVICDNTGLTRVPMDAFQVGKFPEDFES
CDSITGMNLEAWRETFPQDDKCGFPESVENGDFVHCEESGRRVLVYSCRHGYELQGREQL
TCTQEGWDFQPPLCKDVNECADGAHPPCHASARCRNTKGGFQCLCADPYELGDDGRTCVD
SGRLPRVTWISMSLAALLIGGFAGLTSTVICRWTRTGTKSTLPISETGGGTPELRCGKHQ
AVGTSPQRAAAQDSEQESAGMEGRDTHRLPRAL
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atgagagcgctcgctgtgctgtctgtcacgctggttatggcctgcacagaagccttcttc
cccttcatctcgagagggaaagaactcctttggggaaagcctgaggagtctcgtgtctct
agcgtcttggaggaaagcaagcgcctggtggacaccgccatgtacgccacgatgcagaga
aacctcaagaaaagaggaatcctttctccagctcagcttctgtctttttccaaacttcct
gagccaacaagcggagtgattgcccgagcagcagagataatggaaacatcaatacaagcg
atgaaaagaaaagtcaacctgaaaactcaacaatcacagcatccaacggatgctttatca
gaagatctgctgagcatcattgcaaacatgtctggatgtctcccttacatgctgccccca
aaatgcccaaacacttgcctggcgaacaaatacaggcccatcacaggagcttgcaacaac
agagaccaccccagatggggcgcctccaacacggccctggcacgatggctccctccagtc
tatgaggacggcttcagtcagccccgaggctggaaccccggcttcttgtacaacgggttc
ccactgcccccggtccgggaggtgacaagacatgtcattcaagtttcaaatgaggttgtc
acagatgatgaccgctattctgacctcctgatggcatggggacaatacatcgaccacgac
atcgcgttcacaccacagagcaccagcaaagctgccttcgggggaggggctgactgccag
atgacttgtgagaaccaaaacccatgttttcccatacaactcccggaggaggcccggccg
gccgcgggcaccgcctgtctgcccttctaccgctcttcggccgcctgcggcaccggggac
caaggcgcgctctttgggaacctgtccacggccaacccgcggcagcagatgaacgggttg
acctcgttcctggacgcgtccaccgtgtatggcagctccccggccctagagaggcagctg
cggaactggaccagtgccgaagggctgctccgcgtccacgcgcgcctccgggactccggc
cgcgcctacctgcccttcgtgccgccacgcgcgcctgcggcctgtgcgcccgagcccggc
atccccggagagacccgcgggccctgcttcctggccggagacggccgcgccagcgaggtc
ccctccctgacggcactgcacacgctgtggctgcgcgagcacaaccgcctggccgcggcg
ctcaaggccctcaatgcgcactggagcgcggacgccgtgtaccaggaggcgcgcaaggtc
gtgggcgctctgcaccagatcatcaccctgagggattacatccccaggatcctgggaccc
gaggccttccagcagtacgtgggtccctatgaaggctatgactccaccgccaaccccact
gtgtccaacgtgttctccacagccgccttccgcttcggccatgccacgatccacccgctg
gtgaggaggctggacgccagcttccaggagcaccccgacctgcccgggctgtggctgcac
caggctttcttcagcccatggacattactccgtggaggtggtttggacccactaatacga
ggccttcttgcaagaccagccaaactgcaggtgcaggatcagctgatgaacgaggagctg
acggaaaggctctttgtgctgtccaattccagcaccttggatctggcgtccatcaacctg
cagaggggccgggaccacgggctgccaggttacaatgagtggagggagttctgcggcctg
cctcgcctggagacccccgctgacctgagcacagccatcgccagcaggagcgtggccgac
aagatcctggacttgtacaagcatcctgacaacatcgatgtctggctgggaggcttagct
gaaaacttcctccccagggctcggacagggcccctgtttgcctgtctcattgggaagcag
atgaaggctctgcgggacggtgactggttttggtgggagaacagccacgtcttcacggat
gcacagaggcgtgagctggagaagcactccctgtctcgggtcatctgtgacaacactggc
ctcaccagggtgcccatggatgccttccaagtcggcaaattccccgaagactttgagtct
tgtgacagcatcactggcatgaacctggaggcctggagggaaacctttcctcaagacgac
aagtgtggcttcccagagagcgtggagaatggggactttgtgcactgtgaggagtctggg
aggcgcgtgctggtgtattcctgccggcacgggtatgagctccaaggccgggagcagctc
acttgcacccaggaaggatgggatttccagcctcccctctgcaaagatgtgaacgagtgt
gcagacggtgcccaccccccctgccacgcctctgcgaggtgcagaaacaccaaaggcggc
ttccagtgtctctgcgcggacccctacgagttaggagacgatgggagaacctgcgtagac
tccgggaggctccctcgggtgacttggatctccatgtcgctggctgctctgctgatcgga
ggcttcgcaggtctcacctcgacggtgatttgcaggtggacacgcactggcactaaatcc
acactgcccatctcggagacaggcggaggaactcccgagctgagatgcggaaagcaccag
gccgtagggacctcaccgcagcgggccgcagctcaggactcggagcaggagagtgctggg
atggaaggccgggatactcacaggctgccgagagccctctga

DBGET integrated database retrieval system