KEGG   Homo sapiens (human): 7173Help
Entry
7173              CDS       T01001                                 

Gene name
TPO, MSA, TDH2A, TPX
Definition
thyroid peroxidase (EC:1.11.1.8)
Orthology
K00431  
thyroid peroxidase [EC:1.11.1.8]
Organism
hsa  Homo sapiens (human)
Pathway
Tyrosine metabolism
Metabolic pathways
Thyroid hormone synthesis
Autoimmune thyroid disease
Module
Thyroid hormone biosynthesis, tyrosine => triiodothyronine/thyroxine
Disease
H00251  
Thyroid dyshormonogenesis
Drug target
Methylthiouracil: 
Propylthiouracil: 
Benzylthiouracil: 
Thiamazole: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    7173 (TPO)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    7173 (TPO)
 Human Diseases
  Immune diseases
   05320 Autoimmune thyroid disease
    7173 (TPO)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.8  iodide peroxidase
     7173 (TPO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p25
AA seq 933 aa AA seqDB search
MRALAVLSVTLVMACTEAFFPFISRGKELLWGKPEESRVSSVLEESKRLVDTAMYATMQR
NLKKRGILSPAQLLSFSKLPEPTSGVIARAAEIMETSIQAMKRKVNLKTQQSQHPTDALS
EDLLSIIANMSGCLPYMLPPKCPNTCLANKYRPITGACNNRDHPRWGASNTALARWLPPV
YEDGFSQPRGWNPGFLYNGFPLPPVREVTRHVIQVSNEVVTDDDRYSDLLMAWGQYIDHD
IAFTPQSTSKAAFGGGADCQMTCENQNPCFPIQLPEEARPAAGTACLPFYRSSAACGTGD
QGALFGNLSTANPRQQMNGLTSFLDASTVYGSSPALERQLRNWTSAEGLLRVHARLRDSG
RAYLPFVPPRAPAACAPEPGIPGETRGPCFLAGDGRASEVPSLTALHTLWLREHNRLAAA
LKALNAHWSADAVYQEARKVVGALHQIITLRDYIPRILGPEAFQQYVGPYEGYDSTANPT
VSNVFSTAAFRFGHATIHPLVRRLDASFQEHPDLPGLWLHQAFFSPWTLLRGGGLDPLIR
GLLARPAKLQVQDQLMNEELTERLFVLSNSSTLDLASINLQRGRDHGLPGYNEWREFCGL
PRLETPADLSTAIASRSVADKILDLYKHPDNIDVWLGGLAENFLPRARTGPLFACLIGKQ
MKALRDGDWFWWENSHVFTDAQRRELEKHSLSRVICDNTGLTRVPMDAFQVGKFPEDFES
CDSITGMNLEAWRETFPQDDKCGFPESVENGDFVHCEESGRRVLVYSCRHGYELQGREQL
TCTQEGWDFQPPLCKDVNECADGAHPPCHASARCRNTKGGFQCLCADPYELGDDGRTCVD
SGRLPRVTWISMSLAALLIGGFAGLTSTVICRWTRTGTKSTLPISETGGGTPELRCGKHQ
AVGTSPQRAAAQDSEQESAGMEGRDTHRLPRAL
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atgagagcgctcgctgtgctgtctgtcacgctggttatggcctgcacagaagccttcttc
cccttcatctcgagagggaaagaactcctttggggaaagcctgaggagtctcgtgtctct
agcgtcttggaggaaagcaagcgcctggtggacaccgccatgtacgccacgatgcagaga
aacctcaagaaaagaggaatcctttctccagctcagcttctgtctttttccaaacttcct
gagccaacaagcggagtgattgcccgagcagcagagataatggaaacatcaatacaagcg
atgaaaagaaaagtcaacctgaaaactcaacaatcacagcatccaacggatgctttatca
gaagatctgctgagcatcattgcaaacatgtctggatgtctcccttacatgctgccccca
aaatgcccaaacacttgcctggcgaacaaatacaggcccatcacaggagcttgcaacaac
agagaccaccccagatggggcgcctccaacacggccctggcacgatggctccctccagtc
tatgaggacggcttcagtcagccccgaggctggaaccccggcttcttgtacaacgggttc
ccactgcccccggtccgggaggtgacaagacatgtcattcaagtttcaaatgaggttgtc
acagatgatgaccgctattctgacctcctgatggcatggggacaatacatcgaccacgac
atcgcgttcacaccacagagcaccagcaaagctgccttcgggggaggggctgactgccag
atgacttgtgagaaccaaaacccatgttttcccatacaactcccggaggaggcccggccg
gccgcgggcaccgcctgtctgcccttctaccgctcttcggccgcctgcggcaccggggac
caaggcgcgctctttgggaacctgtccacggccaacccgcggcagcagatgaacgggttg
acctcgttcctggacgcgtccaccgtgtatggcagctccccggccctagagaggcagctg
cggaactggaccagtgccgaagggctgctccgcgtccacgcgcgcctccgggactccggc
cgcgcctacctgcccttcgtgccgccacgcgcgcctgcggcctgtgcgcccgagcccggc
atccccggagagacccgcgggccctgcttcctggccggagacggccgcgccagcgaggtc
ccctccctgacggcactgcacacgctgtggctgcgcgagcacaaccgcctggccgcggcg
ctcaaggccctcaatgcgcactggagcgcggacgccgtgtaccaggaggcgcgcaaggtc
gtgggcgctctgcaccagatcatcaccctgagggattacatccccaggatcctgggaccc
gaggccttccagcagtacgtgggtccctatgaaggctatgactccaccgccaaccccact
gtgtccaacgtgttctccacagccgccttccgcttcggccatgccacgatccacccgctg
gtgaggaggctggacgccagcttccaggagcaccccgacctgcccgggctgtggctgcac
caggctttcttcagcccatggacattactccgtggaggtggtttggacccactaatacga
ggccttcttgcaagaccagccaaactgcaggtgcaggatcagctgatgaacgaggagctg
acggaaaggctctttgtgctgtccaattccagcaccttggatctggcgtccatcaacctg
cagaggggccgggaccacgggctgccaggttacaatgagtggagggagttctgcggcctg
cctcgcctggagacccccgctgacctgagcacagccatcgccagcaggagcgtggccgac
aagatcctggacttgtacaagcatcctgacaacatcgatgtctggctgggaggcttagct
gaaaacttcctccccagggctcggacagggcccctgtttgcctgtctcattgggaagcag
atgaaggctctgcgggacggtgactggttttggtgggagaacagccacgtcttcacggat
gcacagaggcgtgagctggagaagcactccctgtctcgggtcatctgtgacaacactggc
ctcaccagggtgcccatggatgccttccaagtcggcaaattccccgaagactttgagtct
tgtgacagcatcactggcatgaacctggaggcctggagggaaacctttcctcaagacgac
aagtgtggcttcccagagagcgtggagaatggggactttgtgcactgtgaggagtctggg
aggcgcgtgctggtgtattcctgccggcacgggtatgagctccaaggccgggagcagctc
acttgcacccaggaaggatgggatttccagcctcccctctgcaaagatgtgaacgagtgt
gcagacggtgcccaccccccctgccacgcctctgcgaggtgcagaaacaccaaaggcggc
ttccagtgtctctgcgcggacccctacgagttaggagacgatgggagaacctgcgtagac
tccgggaggctccctcgggtgacttggatctccatgtcgctggctgctctgctgatcgga
ggcttcgcaggtctcacctcgacggtgatttgcaggtggacacgcactggcactaaatcc
acactgcccatctcggagacaggcggaggaactcccgagctgagatgcggaaagcaccag
gccgtagggacctcaccgcagcgggccgcagctcaggactcggagcaggagagtgctggg
atggaaggccgggatactcacaggctgccgagagccctctga

DBGET integrated database retrieval system