KEGG   Homo sapiens (human): 7175Help
Entry
7175              CDS       T01001                                 

Gene name
TPR
Definition
(RefSeq) translocated promoter region, nuclear basket protein
  KO
K09291  
nucleoprotein TPR
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Pathways in cancer
Thyroid cancer
Module
Nuclear pore complex
Disease
H00032  
Thyroid cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    7175 (TPR)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7175 (TPR)
   05216 Thyroid cancer
    7175 (TPR)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     7175 (TPR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P12270(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
1q31.1
AA seq 2363 aa AA seqDB search
MAAVLQQVLERTELNKLPKSVQNKLEKFLADQQSEIDGLKGRHEKFKVESEQQYFEIEKR
LSHSQERLVNETRECQSLRLELEKLNNQLKALTEKNKELEIAQDRNIAIQSQFTRTKEEL
EAEKRDLIRTNERLSQELEYLTEDVKRLNEKLKESNTTKGELQLKLDELQASDVSVKYRE
KRLEQEKELLHSQNTWLNTELKTKTDELLALGREKGNEILELKCNLENKKEEVSRLEEQM
NGLKTSNEHLQKHVEDLLTKLKEAKEQQASMEEKFHNELNAHIKLSNLYKSAADDSEAKS
NELTRAVEELHKLLKEAGEANKAIQDHLLEVEQSKDQMEKEMLEKIGRLEKELENANDLL
SATKRKGAILSEEELAAMSPTAAAVAKIVKPGMKLTELYNAYVETQDQLLLEKLENKRIN
KYLDEIVKEVEAKAPILKRQREEYERAQKAVASLSVKLEQAMKEIQRLQEDTDKANKQSS
VLERDNRRMEIQVKDLSQQIRVLLMELEEARGNHVIRDEEVSSADISSSSEVISQHLVSY
RNIEELQQQNQRLLVALRELGETREREEQETTSSKITELQLKLESALTELEQLRKSRQHQ
MQLVDSIVRQRDMYRILLSQTTGVAIPLHASSLDDVSLASTPKRPSTSQTVSTPAPVPVI
ESTEAIEAKAALKQLQEIFENYKKEKAENEKIQNEQLEKLQEQVTDLRSQNTKISTQLDF
ASKRYEMLQDNVEGYRREITSLHERNQKLTATTQKQEQIINTMTQDLRGANEKLAVAEVR
AENLKKEKEMLKLSEVRLSQQRESLLAEQRGQNLLLTNLQTIQGILERSETETKQRLSSQ
IEKLEHEISHLKKKLENEVEQRHTLTRNLDVQLLDTKRQLDTETNLHLNTKELLKNAQKE
IATLKQHLSNMEVQVASQSSQRTGKGQPSNKEDVDDLVSQLRQTEEQVNDLKERLKTSTS
NVEQYQAMVTSLEESLNKEKQVTEEVRKNIEVRLKESAEFQTQLEKKLMEVEKEKQELQD
DKRRAIESMEQQLSELKKTLSSVQNEVQEALQRASTALSNEQQARRDCQEQAKIAVEAQN
KYERELMLHAADVEALQAAKEQVSKMASVRQHLEETTQKAESQLLECKASWEERERMLKD
EVSKCVCRCEDLEKQNRLLHDQIEKLSDKVVASVKEGVQGPLNVSLSEEGKSQEQILEIL
RFIRREKEIAETRFEVAQVESLRYRQRVELLERELQELQDSLNAEREKVQVTAKTMAQHE
ELMKKTETMNVVMETNKMLREEKERLEQDLQQMQAKVRKLELDILPLQEANAELSEKSGM
LQAEKKLLEEDVKRWKARNQHLVSQQKDPDTEEYRKLLSEKEVHTKRIQQLTEEIGRLKA
EIARSNASLTNNQNLIQSLKEDLNKVRTEKETIQKDLDAKIIDIQEKVKTITQVKKIGRR
YKTQYEELKAQQDKVMETSAQSSGDHQEQHVSVQEMQELKETLNQAETKSKSLESQVENL
QKTLSEKETEARNLQEQTVQLQSELSRLRQDLQDRTTQEEQLRQQITEKEEKTRKAIVAA
KSKIAHLAGVKDQLTKENEELKQRNGALDQQKDELDVRITALKSQYEGRISRLERELREH
QERHLEQRDEPQEPSNKVPEQQRQITLKTTPASGERGIASTSDPPTANIKPTPVVSTPSK
VTAAAMAGNKSTPRASIRPMVTPATVTNPTTTPTATVMPTTQVESQEAMQSEGPVEHVPV
FGSTSGSVRSTSPNVQPSISQPILTVQQQTQATAFVQPTQQSHPQIEPANQELSSNIVEV
VQSSPVERPSTSTAVFGTVSATPSSSLPKRTREEEEDSTIEASDQVSDDTVEMPLPKKLK
SVTPVGTEEEVMAEESTDGEVETQVYNQDSQDSIGEGVTQGDYTPMEDSEETSQSLQIDL
GPLQSDQQTTTSSQDGQGKGDDVIVIDSDDEEEDDDENDGEHEDYEEDEEDDDDDEDDTG
MGDEGEDSNEGTGSADGNDGYEADDAEGGDGTDPGTETEESMGGGEGNHRAADSQNSGEG
NTGAAESSFSQEVSREQQPSSASERQAPRAPQSPRRPPHPLPPRLTIHAPPQELGPPVQR
IQMTRRQSVGRGLQLTPGIGGMQQHFFDDEDRTVPSTPTLVVPHRTDGFAEAIHSPQVAG
VPRFRFGPPEDMPQTSSSHSDLGQLASQGGLGMYETPLFLAHEEESGGRSVPTTPLQVAA
PVTVFTESTTSDASEHASQSVPMVTTSTGTLSTTNETATGDDGDEVFVEAESEGISSEAG
LEIDSQQEEEPVQASDESDLPSTSQDPPSSSSVDTSSSQPKPFRRVRLQTTLRQGVRGRQ
FNRQRGVSHAMGGRGGINRGNIN
NT seq 7092 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtgttgcagcaagtcctggagcgcacggagctgaacaagctgcccaagtct
gtccagaacaaacttgaaaagttccttgctgatcagcaatccgagatcgatggcctgaag
gggcggcatgagaaatttaaggtggagagcgaacaacagtattttgaaatagaaaagagg
ttgtcccacagtcaggagagacttgtgaatgaaacccgagagtgtcaaagcttgcggctt
gagctagagaaactcaacaatcaactgaaggcactaactgagaaaaacaaagaacttgaa
attgctcaggatcgcaatattgccattcagagccaatttacaagaacaaaggaagaatta
gaagctgagaaaagagacttaattagaaccaatgagagactatctcaagaacttgaatac
ttaacagaggatgttaaacgtctgaatgaaaaacttaaagaaagcaatacaacaaagggt
gaacttcagttaaaattggatgaacttcaagcttctgatgtttctgttaagtatcgagaa
aaacgcttggagcaagaaaaggaattgctacatagtcagaatacatggctgaatacagag
ttgaaaaccaaaactgatgaacttctggctcttggaagagaaaaagggaatgagattcta
gagcttaaatgtaatcttgaaaataaaaaagaagaggtttctagactggaagaacaaatg
aatggcttaaaaacatcaaatgaacatcttcaaaagcatgtggaggatctgttgaccaaa
ttaaaagaggccaaggaacaacaggccagtatggaagagaaattccacaatgaattaaat
gcccacataaaactttctaatttgtacaagagtgccgctgatgactcagaagcaaagagc
aatgaactaacccgggcagtagaggaactacacaaacttttgaaagaagctggtgaagcc
aacaaagcaatacaagatcatcttctagaggtggagcaatccaaagatcaaatggaaaaa
gaaatgcttgagaaaatagggagattggagaaggaattagagaatgcaaatgaccttctt
tctgccacaaaacgtaaaggagccatattgtctgaagaagagcttgccgccatgtctcct
actgcagcagctgtagctaagatagtgaaacctgggatgaaactaactgagctctataat
gcttatgtggaaactcaggatcagttgcttttggagaaactagagaacaaaagaattaat
aagtacctagatgaaatagtgaaagaagtggaagccaaagcaccaattttgaaacgccag
cgtgaggaatatgaacgtgcacagaaagctgtagcaagtttatctgttaagcttgaacaa
gctatgaaggagattcagcgattgcaggaggacactgataaagccaacaagcaatcatct
gtacttgagagagataatcgaagaatggaaatacaagtaaaagatctttcacaacagatt
agagtgcttttgatggaacttgaagaagcaaggggtaaccacgtaattcgtgatgaggaa
gtaagctctgctgatataagtagttcatctgaggtaatatcacagcatctagtatcttac
agaaatattgaagagcttcaacaacaaaatcaacgtctcttagtggcccttagagagctt
ggggaaaccagagaaagagaagaacaagaaacaacttcatccaaaatcactgagcttcag
ctcaaacttgagagtgcccttactgaactagaacaactccgcaaatcacgacagcatcaa
atgcagcttgttgattccatagttcgtcagcgtgatatgtaccgtattttattgtcacaa
acaacaggagttgccattccattacatgcttcaagcttagatgatgtttctcttgcatca
actccaaaacgtccaagtacatcacagactgtttccactcctgctccagtacctgttatt
gaatcaacagaggctatagaggctaaggctgcccttaaacagttgcaggaaatttttgag
aactacaaaaaagaaaaagcagaaaatgaaaaaatacaaaatgagcagcttgagaaactt
caagaacaagttacagatttgcgatcacaaaataccaaaatttctacccagctagatttt
gcttctaaacgttatgaaatgctgcaagataatgttgaaggatatcgtcgagaaataaca
tcacttcatgagagaaatcagaaactcactgccacaactcaaaagcaagaacagattatc
aatacgatgactcaagatttgagaggagcaaatgagaagctagctgtcgcagaagtaaga
gcagaaaatttgaagaaggaaaaggaaatgcttaaattgtctgaagttcgtctttctcag
caaagagagtctttgttagctgaacaaagggggcaaaacttactgctaactaatctgcaa
acaattcagggaatactggagcgatctgaaacagaaaccaaacaaaggcttagtagccag
atagaaaaactggaacatgagatctctcatctaaagaagaagttggaaaatgaggtggaa
caaaggcatacacttactagaaatctagatgttcaacttttagatacaaagagacaactg
gatacagagacaaatcttcatcttaacacaaaagaactattaaaaaatgctcaaaaagaa
attgccacattgaaacagcacctcagtaatatggaagtccaagttgcttctcagtcttca
cagagaactggtaaaggtcagcctagcaacaaagaagatgtggatgatcttgtgagtcag
ctaagacagacagaagagcaggtgaatgacttaaaggagagactcaaaacaagtacgagc
aatgtggaacaatatcaagcaatggttactagtttagaagaatccctgaacaaggaaaaa
caggtgacagaagaagtgcgtaagaatattgaagttcgtttaaaagagtcagctgaattt
cagacacagttggaaaagaagttgatggaagtagagaaggaaaaacaagaacttcaggat
gataaaagaagagccatagagagcatggaacaacagttatctgaattgaagaaaacactt
tctagtgttcagaatgaagtacaagaagctcttcagagagcaagcacagctttaagtaat
gagcagcaagccagacgtgactgtcaggaacaagctaaaatagctgtggaagctcagaat
aagtatgagagagaattgatgctgcatgctgctgatgttgaagctctacaagctgcgaag
gagcaggtttcaaaaatggcatcagtccgtcagcatttggaagaaacaacacagaaagca
gaatcacagttgttggagtgtaaagcatcttgggaggaaagagagagaatgttaaaggat
gaagtttccaaatgtgtatgtcgctgtgaagatctggagaaacaaaacagattacttcat
gatcagatcgaaaaattaagtgacaaggtcgttgcctctgtgaaggaaggtgtacaaggt
ccactgaatgtatctctcagtgaagaaggaaaatctcaagaacaaattttggaaattctc
agatttatacgacgagaaaaagaaattgctgaaactaggtttgaggtggctcaggttgag
agtctgcgttatcgacaaagggttgaacttttagaaagagagctgcaggaactgcaagat
agtctaaatgctgaaagggagaaagtccaggtaactgcaaaaacaatggctcagcatgaa
gaactgatgaagaaaactgaaacaatgaatgtagttatggagaccaataaaatgctaaga
gaagagaaggagagactagaacaggatctacagcaaatgcaagcaaaggtgaggaaactg
gagttagatattttacccttacaagaagcaaatgctgagctgagtgagaaaagcggtatg
ttgcaggcagagaagaagctcttagaagaggatgtcaaacgttggaaagcacgtaaccag
catctagtaagtcaacagaaagatccagatacagaagaatatcggaagctcctttctgaa
aaggaagttcatactaagcgtattcaacaattgacagaagaaattggtagacttaaagct
gaaattgcaagatcaaatgcatctttgactaacaaccagaacttaattcagagtctgaag
gaagatctaaataaagtaagaactgaaaaggaaaccatccagaaggacttagatgccaaa
ataattgatatccaagaaaaagtcaaaactattactcaagttaagaaaattggacgtagg
tacaagactcaatatgaagaacttaaagcacaacaggataaggttatggagacatcggct
cagtcctctggagaccatcaggagcagcatgtttcagtccaggaaatgcaggaactcaaa
gaaacgctcaaccaagctgaaacaaaatcaaaatcacttgaaagtcaagtagagaatctg
cagaagacattatctgaaaaagagacagaagcaagaaatctccaggaacagactgtgcaa
cttcagtctgaactttcacgacttcgtcaggatcttcaagatagaaccacacaggaggag
cagctccgacaacagataactgaaaaggaagaaaaaaccagaaaggctattgtagcagca
aagtcaaaaattgcacacttagctggtgtaaaagatcagctaactaaagaaaatgaggag
cttaaacaaaggaatggagccttagatcagcagaaagatgaattggatgttcgcattact
gcgctaaagtcccaatatgaaggtcgaattagtcgcttggaaagagaactcagggagcat
caagagagacaccttgagcagagagatgagcctcaagaaccttctaataaggtccctgaa
cagcagagacagatcacattgaaaacaactccagcttctggtgaaagaggaattgccagc
acatcagacccaccaacagccaatatcaagccaactcctgttgtgtctactccaagtaaa
gtgacagctgcagctatggctggaaataagtcaacacccagggctagtatccgcccaatg
gttacacctgcaactgttacaaatcccactactaccccaacagctacagtgatgcccact
acacaagtggaatcacaggaagctatgcagtcagaagggcctgtggaacatgttccagtt
tttggaagcacaagtggatccgttcgttctactagtcctaatgtccagccttctatctct
caacctattttaactgttcagcaacaaacacaggctacagcttttgtgcaacccactcaa
cagagtcatcctcagattgagcctgccaatcaagagttatcttcaaacatagtagaggtt
gttcagagttcaccagttgagcggccttctacttccacagcagtatttggcacagtttcg
gctacccccagttcttctttgccaaagcgtacacgtgaagaggaagaggatagcaccata
gaagcatcagaccaagtctctgatgatacagtggaaatgcctcttccaaagaagttgaaa
agtgtcacacctgtaggaactgaggaagaagttatggcagaagaaagtactgatggagag
gtagagactcaggtatacaaccaggattctcaagattccattggagaaggagttacccag
ggagattatacacctatggaagacagtgaagaaacctctcagtctctacaaatagatctt
gggccacttcaatcagatcagcagacgacaacttcatcccaggatggtcaaggcaaagga
gatgatgtcattgtaattgacagtgatgatgaagaagaggatgatgatgaaaatgatgga
gaacatgaggattatgaagaggatgaggaagatgatgatgatgatgaagatgacacaggg
atgggagatgagggtgaagatagtaatgaaggaactggtagtgccgatggcaatgatggt
tatgaagctgatgatgctgagggtggtgatgggactgatccaggtacagaaacagaagaa
agtatgggtggaggtgaaggtaatcacagagctgctgattctcaaaacagtggtgaagga
aatacaggtgctgcagaatcttctttttctcaggaggtttctagagaacaacagccatca
tcagcatctgaaagacaggcccctcgagcacctcagtcaccgagacgcccaccacatcca
cttcccccaagactgaccattcatgccccacctcaggagttgggaccaccagttcagaga
attcagatgacccgaaggcagtctgtaggacgtggccttcagttgactccaggaataggt
ggcatgcaacagcatttttttgatgatgaagacagaacagttccaagtactccaactctt
gtggtgccacatcgtactgatggatttgctgaagcaattcattcgccgcaggttgctggt
gtccctagattccggtttgggccacctgaagatatgccacaaacaagttctagtcactct
gatcttggccagcttgcttctcaaggaggtttaggaatgtatgaaacacccctgttccta
gctcatgaagaagagtcaggtggccgaagtgttcccactactccactacaagtagcagcc
ccagtgactgtatttactgagagcaccacctctgatgcttcggaacatgcctctcaatct
gttccaatggtgactacatccactggcactttatctacaacaaatgaaacagcaacaggt
gatgatggagatgaagtatttgtggaggcagaatctgaaggtattagttcagaagcaggc
ctagaaattgatagccagcaggaagaagagccggttcaagcatctgatgagtcagatctc
ccctccaccagccaggatcctccttctagctcatctgtagatactagtagtagtcaacca
aagcctttcagacgagtaagacttcagacaacattgagacaaggtgtccgtggtcgtcag
tttaacagacagagaggtgtgagccatgcaatgggagggagaggaggaataaacagagga
aatattaattaa

DBGET integrated database retrieval system