KEGG   Homo sapiens (human): 7177Help
Entry
7177              CDS       T01001                                 

Gene name
TPSAB1, TPS1, TPS2, TPSB1
Definition
(RefSeq) tryptase alpha/beta 1 (EC:3.4.21.59)
  KO
K01340  
tryptase [EC:3.4.21.59]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.59  tryptase
     7177 (TPSAB1)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   7177 (TPSAB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16p13.3
AA seq 275 aa AA seqDB search
MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCG
GSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGA
DIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKV
PIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAG
VVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgctgaatctgctgctgctggcgctgcccgtcctggcgagccgcgcctacgcggcccct
gccccaggccaggccctgcagcgagtgggcatcgtcgggggtcaggaggcccccaggagc
aagtggccctggcaggtgagcctgagagtccacggcccatactggatgcacttctgcggg
ggctccctcatccacccccagtgggtgctgaccgcagcgcactgcgtgggaccggacgtc
aaggatctggccgccctcagggtgcaactgcgggagcagcacctctactaccaggaccag
ctgctgccggtcagcaggatcatcgtgcacccacagttctacaccgcccagatcggagcg
gacatcgccctgctggagctggaggagccggtgaacgtctccagccacgtccacacggtc
accctgccccctgcctcagagaccttccccccggggatgccgtgctgggtcactggctgg
ggcgatgtggacaatgatgagcgcctcccaccgccatttcctctgaagcaggtgaaggtc
cccataatggaaaaccacatttgtgacgcaaaataccaccttggcgcctacacgggagac
gacgtccgcatcgtccgtgacgacatgctgtgtgccgggaacacccggagggactcatgc
cagggcgactccggagggcccctggtgtgcaaggtgaatggcacctggctgcaggcgggc
gtggtcagctggggcgagggctgtgcccagcccaaccggcctggcatctacacccgtgtc
acctactacttggactggatccaccactatgtccccaaaaagccgtga

DBGET integrated database retrieval system