KEGG   Homo sapiens (human): 7182Help
Entry
7182              CDS       T01001                                 

Gene name
NR2C2, TAK1, TR4
Definition
(RefSeq) nuclear receptor subfamily 2 group C member 2
  KO
K08544  
testicular receptor 4
Organism
hsa  Homo sapiens (human)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    7182 (NR2C2)
Nuclear receptors [BR:hsa03310]
 2. Hepatocyte nuclear factor 4 like
  2C. Testicular receptor
   7182 (NR2C2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p25
AA seq 596 aa AA seqDB search
MTSPSPRIQIISTDSAVASPQRIQIVTDQQTGQKIQIVTAVDASGSPKQQFILTSPDGAG
TGKVILASPETSSAKQLIFTTSDNLVPGRIQIVTDSASVERLLGKTDVQRPQVVEYCVVC
GDKASGRHYGAVSCEGCKGFFKRSVRKNLTYSCRSNQDCIINKHHRNRCQFCRLKKCLEM
GMKMESVQSERKPFDVQREKPSNCAASTEKIYIRKDLRSPLIATPTFVADKDGARQTGLL
DPGMLVNIQQPLIREDGTVLLATDSKAETSQGALGTLANVVTSLANLSESLNNGDTSEIQ
PEDQSASEITRAFDTLAKALNTTDSSSSPSLADGIDTSGGGSIHVISRDQSTPIIEVEGP
LLSDTHVTFKLTMPSPMPEYLNVHYICESASRLLFLSMHWARSIPAFQALGQDCNTSLVR
ACWNELFTLGLAQCAQVMSLSTILAAIVNHLQNSIQEDKLSGDRIKQVMEHIWKLQEFCN
SMAKLDIDGYEYAYLKAIVLFSPDHPGLTSTSQIEKFQEKAQMELQDYVQKTYSEDTYRL
ARILVRLPALRLMSSNITEELFFTGLIGNVSIDSIIPYILKMETAEYNGQITGASL
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcccctccccacgcatccagataatctccaccgactctgctgtagcctcacct
cagcgcattcagattgtcacagaccagcagacaggacagaaaatccagatagtcaccgca
gtggacgcctccggatcccccaaacagcagttcatcctgaccagcccagatggagctgga
actgggaaggtgatcctggcttccccagagacatccagcgccaagcaactcatattcacc
acctcagacaacctcgtccctggcaggatccagattgtcacggattctgcctctgtggag
cgtttactggggaagacggacgtccagcggccccaggtggtagagtactgtgtggtctgt
ggcgacaaagcctccggccgtcactatggggctgtcagttgtgaaggttgcaaaggtttc
ttcaaaaggagtgtgaggaaaaatttgacctacagctgccggagcaaccaagactgcatc
atcaataaacatcaccggaaccgctgtcagttttgccggctgaaaaaatgcttagagatg
ggcatgaaaatggaatctgtgcagagtgaacggaagcccttcgatgtgcaacgggagaaa
ccaagcaattgtgctgcttcaactgagaaaatctatatccggaaagacctgagaagtccc
ctgatagctactcccacgtttgtggcagacaaagatggagcaagacaaacaggtcttctt
gatccagggatgcttgtgaacatccagcagcctttgatacgtgaggatggtacagttctc
ctggccacggattctaaggctgaaacaagccagggagctctgggcacactggcaaatgta
gtgacctcccttgccaacctaagtgaatctttgaacaacggtgacacttcagaaatccag
ccagaggaccagtctgcaagtgagataactcgggcatttgataccttagctaaagcactt
aataccacagacagctcctcttctccaagcttggcagatgggatagacaccagtggagga
gggagcatccacgtcatcagcagagaccagtcgacacccatcattgaggttgaaggcccc
ctcctttcagacacacacgtcacatttaagctaacaatgcccagtccaatgccagagtac
ctcaacgtgcactacatctgtgagtctgcatcccgtctgcttttcctctcaatgcactgg
gctcggtcaatcccagcctttcaggcacttgggcaggactgcaacaccagccttgtgcgg
gcctgctggaatgagctcttcaccctcggcctggcccagtgtgcccaggtcatgagtctc
tccaccatcctggctgccattgtcaaccacctgcagaacagcatccaggaagataaactt
tctggtgaccggataaagcaagtcatggagcacatctggaagctgcaggagttctgtaac
agcatggcgaagctggatatagatggctatgagtatgcataccttaaagctatagttctc
tttagccccgatcatccaggtttgaccagcacaagccagattgaaaaattccaagaaaag
gcacagatggagttgcaggactatgttcagaaaacctactcagaagacacctaccgattg
gcccggatcctcgttcgcctgccggcactcaggctgatgagctccaacataacagaagaa
cttttttttactggtctcattggcaatgtttcgatagacagcataatcccctacatcctc
aagatggagacagcagagtataatggccagatcaccggagccagtctatag

DBGET integrated database retrieval system