KEGG   Homo sapiens (human): 7184Help
Entry
7184              CDS       T01001                                 

Gene name
HSP90B1, ECGP, GP96, GRP94, HEL-S-125m, HEL35, TRA1
Definition
heat shock protein 90kDa beta (Grp94), member 1
Orthology
K09487  
heat shock protein 90kDa beta
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
PI3K-Akt signaling pathway
NOD-like receptor signaling pathway
Estrogen signaling pathway
Thyroid hormone synthesis
Pathways in cancer
Prostate cancer
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    7184 (HSP90B1)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    7184 (HSP90B1)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    7184 (HSP90B1)
  Endocrine system
   04915 Estrogen signaling pathway
    7184 (HSP90B1)
   04918 Thyroid hormone synthesis
    7184 (HSP90B1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7184 (HSP90B1)
   05215 Prostate cancer
    7184 (HSP90B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q24.2-q24.3
AA seq 803 aa AA seqDB search
MRALWVLGLCCVLLTFGSVRADDEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDG
LNASQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISL
TDENALSGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTE
AQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNT
LGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTETVEEPMEEEEAAK
EEKEESDDEAAVEEEEEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEVEEDEYKAFYK
SFSKESDDPMAYIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITD
DFHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADDKY
NDTFWKEFGTNIKLGVIEDHSNRTRLAKLLRFQSSHHPTDITSLDQYVERMKEKQDKIYF
MAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDE
SEKTKESREAVEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMER
IMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRIKEDEDDKTVLDLAVVLFET
ATLRSGYLLPDTKAYGDRIERMLRLSLNIDPDAKVEEEPEEEPEETAEDTTEDTEQDEDE
EMDVGTDEEEETAKESTAEKDEL
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgagggccctgtgggtgctgggcctctgctgcgtcctgctgaccttcgggtcggtcaga
gctgacgatgaagttgatgtggatggtacagtagaagaggatctgggtaaaagtagagaa
ggatcaaggacggatgatgaagtagtacagagagaggaagaagctattcagttggatgga
ttaaatgcatcacaaataagagaacttagagagaagtcggaaaagtttgccttccaagcc
gaagttaacagaatgatgaaacttatcatcaattcattgtataaaaataaagagattttc
ctgagagaactgatttcaaatgcttctgatgctttagataagataaggctaatatcactg
actgatgaaaatgctctttctggaaatgaggaactaacagtcaaaattaagtgtgataag
gagaagaacctgctgcatgtcacagacaccggtgtaggaatgaccagagaagagttggtt
aaaaaccttggtaccatagccaaatctgggacaagcgagtttttaaacaaaatgactgaa
gcacaggaagatggccagtcaacttctgaattgattggccagtttggtgtcggtttctat
tccgccttccttgtagcagataaggttattgtcacttcaaaacacaacaacgatacccag
cacatctgggagtctgactccaatgaattttctgtaattgctgacccaagaggaaacact
ctaggacggggaacgacaattacccttgtcttaaaagaagaagcatctgattaccttgaa
ttggatacaattaaaaatctcgtcaaaaaatattcacagttcataaactttcctatttat
gtatggagcagcaagactgaaactgttgaggagcccatggaggaagaagaagcagccaaa
gaagagaaagaagaatctgatgatgaagctgcagtagaggaagaagaagaagaaaagaaa
ccaaagactaaaaaagttgaaaaaactgtctgggactgggaacttatgaatgatatcaaa
ccaatatggcagagaccatcaaaagaagtagaagaagatgaatacaaagctttctacaaa
tcattttcaaaggaaagtgatgaccccatggcttatattcactttactgctgaaggggaa
gttaccttcaaatcaattttatttgtacccacatctgctccacgtggtctgtttgacgaa
tatggatctaaaaagagcgattacattaagctctatgtgcgccgtgtattcatcacagac
gacttccatgatatgatgcctaaatacctcaattttgtcaagggtgtggtggactcagat
gatctccccttgaatgtttcccgcgagactcttcagcaacataaactgcttaaggtgatt
aggaagaagcttgttcgtaaaacgctggacatgatcaagaagattgctgatgataaatac
aatgatactttttggaaagaatttggtaccaacatcaagcttggtgtgattgaagaccac
tcgaatcgaacacgtcttgctaaacttcttaggttccagtcttctcatcatccaactgac
attactagcctagaccagtatgtggaaagaatgaaggaaaaacaagacaaaatctacttc
atggctgggtccagcagaaaagaggctgaatcttctccatttgttgagcgacttctgaaa
aagggctatgaagttatttacctcacagaacctgtggatgaatactgtattcaggccctt
cccgaatttgatgggaagaggttccagaatgttgccaaggaaggagtgaagttcgatgaa
agtgagaaaactaaggagagtcgtgaagcagttgagaaagaatttgagcctctgctgaat
tggatgaaagataaagcccttaaggacaagattgaaaaggctgtggtgtctcagcgcctg
acagaatctccgtgtgctttggtggccagccagtacggatggtctggcaacatggagaga
atcatgaaagcacaagcgtaccaaacgggcaaggacatctctacaaattactatgcgagt
cagaagaaaacatttgaaattaatcccagacacccgctgatcagagacatgcttcgacga
attaaggaagatgaagatgataaaacagttttggatcttgctgtggttttgtttgaaaca
gcaacgcttcggtcagggtatcttttaccagacactaaagcatatggagatagaatagaa
agaatgcttcgcctcagtttgaacattgaccctgatgcaaaggtggaagaagagcccgaa
gaagaacctgaagagacagcagaagacacaacagaagacacagagcaagacgaagatgaa
gaaatggatgtgggaacagatgaagaagaagaaacagcaaaggaatctacagctgaaaaa
gatgaattgtaa

DBGET integrated database retrieval system