KEGG   Homo sapiens (human): 7187Help
Entry
7187              CDS       T01001                                 

Gene name
TRAF3, CAP-1, CAP1, CD40bp, CRAF1, IIAE5, LAP1
Definition
(RefSeq) TNF receptor associated factor 3
  KO
K03174  
TNF receptor-associated factor 3
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
IL-17 signaling pathway
TNF signaling pathway
Hepatitis C
Human papillomavirus infection
Kaposi's sarcoma-associated herpesvirus infection
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Small cell lung cancer
Network
N00148  
TLR3-IRF7 signaling pathway
N00149  
TLR3-IRF3 signaling pathway
N00265  
EBV LMP1 to host-cell-protein activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    7187 (TRAF3)
   04668 TNF signaling pathway
    7187 (TRAF3)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    7187 (TRAF3)
   04621 NOD-like receptor signaling pathway
    7187 (TRAF3)
   04622 RIG-I-like receptor signaling pathway
    7187 (TRAF3)
   04657 IL-17 signaling pathway
    7187 (TRAF3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7187 (TRAF3)
   05203 Viral carcinogenesis
    7187 (TRAF3)
   05222 Small cell lung cancer
    7187 (TRAF3)
  Infectious diseases
   05160 Hepatitis C
    7187 (TRAF3)
   05168 Herpes simplex infection
    7187 (TRAF3)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    7187 (TRAF3)
   05169 Epstein-Barr virus infection
    7187 (TRAF3)
   05165 Human papillomavirus infection
    7187 (TRAF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q13114(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
14q32.32
AA seq 568 aa AA seqDB search
MESSKKMDSPGALQTNPPLKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCHLVL
CSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNE
SRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHC
KSQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCV
FQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEI
EIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNR
VTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIW
KIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRG
EYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQ
TVLENGTYIKDDTIFIKVIVDTSDLPDP
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgagtaaaaagatggactctcctggcgcgctgcagactaacccgccgctaaag
ctgcacactgaccgcagtgctgggacgccagtttttgtccctgaacaaggaggttacaag
gaaaagtttgtgaagaccgtggaggacaagtacaagtgtgagaagtgccacctggtgctg
tgcagcccgaagcagaccgagtgtgggcaccgcttctgcgagagctgcatggcggccctg
ctgagctcttcaagtccaaaatgtacagcgtgtcaagagagcatcgttaaagataaggtg
tttaaggataattgctgcaagagagaaattctggctcttcagatctattgtcggaatgaa
agcagaggttgtgcagagcagttaatgctgggacatctgctggtgcatttaaaaaatgat
tgccattttgaagaacttccatgtgtgcgtcctgactgcaaagaaaaggtcttgaggaaa
gacctgcgagaccacgtggagaaggcgtgtaaataccgggaagccacatgcagccactgc
aagagtcaggttccgatgatcgcgctgcagaaacacgaagacaccgactgtccctgcgtg
gtggtgtcctgccctcacaagtgcagcgtccagactctcctgaggagcgagttgagtgca
cacttgtcagagtgtgtcaatgcccccagcacctgtagttttaagcgctatggctgcgtt
tttcaggggacaaaccagcagatcaaggcccacgaggccagctccgccgtgcagcacgtc
aacctgctgaaggagtggagcaactcgctcgaaaagaaggtttccttgttgcagaatgaa
agtgtagaaaaaaacaagagcatacaaagtttgcacaatcagatatgtagctttgaaatt
gaaattgagagacaaaaggaaatgcttcgaaataatgaatccaaaatccttcatttacag
cgagtgatagacagccaagcagagaaactgaaggagcttgacaaggagatccggcccttc
cggcagaactgggaggaagcagacagcatgaagagcagcgtggagtccctccagaaccgc
gtgaccgagctggagagcgtggacaagagcgcggggcaagtggctcggaacacaggcctg
ctggagtcccagctgagccggcatgaccagatgctgagtgtgcacgacatccgcctagcc
gacatggacctgcgcttccaggtcctggagaccgccagctacaatggagtgctcatctgg
aagattcgcgactacaagcggcggaagcaggaggccgtcatggggaagaccctgtccctt
tacagccagcctttctacactggttactttggctataagatgtgtgccagggtctacctg
aacggggacgggatggggaaggggacgcacttgtcgctgttttttgtcatcatgcgtgga
gaatatgatgccctgcttccttggccgtttaagcagaaagtgacactcatgctgatggat
caggggtcctctcgacgtcatttgggagatgcattcaagcccgaccccaacagcagcagc
ttcaagaagcccactggagagatgaatatcgcctctggctgcccagtctttgtggcccaa
actgttctagaaaatgggacatatattaaagatgatacaatttttattaaagtcatagtg
gatacttcggatctgcccgatccctga

DBGET integrated database retrieval system