KEGG   Homo sapiens (human): 7189Help
Entry
7189              CDS       T01001                                 

Gene name
TRAF6, MGC:3310, RNF85
Definition
TNF receptor-associated factor 6, E3 ubiquitin protein ligase
Orthology
K03175  
TNF receptor-associated factor 6
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
NF-kappa B signaling pathway
Ubiquitin mediated proteolysis
Endocytosis
Osteoclast differentiation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Neurotrophin signaling pathway
Pertussis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Hepatitis C
Measles
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    7189 (TRAF6)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    7189 (TRAF6)
   04064 NF-kappa B signaling pathway
    7189 (TRAF6)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    7189 (TRAF6)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    7189 (TRAF6)
   04621 NOD-like receptor signaling pathway
    7189 (TRAF6)
   04622 RIG-I-like receptor signaling pathway
    7189 (TRAF6)
  Nervous system
   04722 Neurotrophin signaling pathway
    7189 (TRAF6)
  Development
   04380 Osteoclast differentiation
    7189 (TRAF6)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7189 (TRAF6)
   05222 Small cell lung cancer
    7189 (TRAF6)
  Infectious diseases
   05133 Pertussis
    7189 (TRAF6)
   05152 Tuberculosis
    7189 (TRAF6)
   05162 Measles
    7189 (TRAF6)
   05160 Hepatitis C
    7189 (TRAF6)
   05168 Herpes simplex infection
    7189 (TRAF6)
   05169 Epstein-Barr virus infection
    7189 (TRAF6)
   05145 Toxoplasmosis
    7189 (TRAF6)
   05140 Leishmaniasis
    7189 (TRAF6)
   05142 Chagas disease (American trypanosomiasis)
    7189 (TRAF6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p12
AA seq 522 aa AA seqDB search
MSLLNCENSCGSSQSESDCCVAMASSCSAVTKDDSVGGTASTGNLSSSFMEEIQGYDVEF
DPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILK
DCPRRQVSCDNCAASMAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPI
PCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIH
QLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNF
GMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDS
HLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLE
ALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgctaaactgtgaaaacagctgtggatccagccagtctgaaagtgactgctgt
gtggccatggccagctcctgtagcgctgtaacaaaagatgatagtgtgggtggaactgcc
agcacggggaacctctccagctcatttatggaggagatccagggatatgatgtagagttt
gacccacccctggaaagcaagtatgaatgccccatctgcttgatggcattacgagaagca
gtgcaaacgccatgcggccataggttctgcaaagcctgcatcataaaatcaataagggat
gcaggtcacaaatgtccagttgacaatgaaatactgctggaaaatcaactatttccagac
aattttgcaaaacgtgagattctttctctgatggtgaaatgtccaaatgaaggttgtttg
cacaagatggaactgagacatcttgaggatcatcaagcacattgtgagtttgctcttatg
gattgtccccaatgccagcgtcccttccaaaaattccatattaatattcacattctgaag
gattgtccaaggagacaggtttcttgtgacaactgtgctgcatcaatggcatttgaagat
aaagagatccatgaccagaactgtcctttggcaaatgtcatctgtgaatactgcaatact
atactcatcagagaacagatgcctaatcattatgatctagactgccctacagccccaatt
ccatgcacattcagtacttttggttgccatgaaaagatgcagaggaatcacttggcacgc
cacctacaagagaacacccagtcacacatgagaatgttggcccaggctgttcatagtttg
agcgttatacccgactctgggtatatctcagaggtccggaatttccaggaaactattcac
cagttagagggtcgccttgtaagacaagaccatcaaatccgggagctgactgctaaaatg
gaaactcagagtatgtatgtaagtgagctcaaacgaaccattcgaacccttgaggacaaa
gttgctgaaatcgaagcacagcagtgcaatggaatttatatttggaagattggcaacttt
ggaatgcatttgaaatgtcaagaagaggagaaacctgttgtgattcatagccctggattc
tacactggcaaacccgggtacaaactgtgcatgcgcttgcaccttcagttaccgactgct
cagcgctgtgcaaactatatatccctttttgtccacacaatgcaaggagaatatgacagc
cacctcccttggcccttccagggtacaatacgccttacaattcttgatcagtctgaagca
cctgtaaggcaaaaccacgaagagataatggatgccaaaccagagctgcttgctttccag
cgacccacaatcccacggaacccaaaaggttttggctatgtaacttttatgcatctggaa
gccctaagacaaagaactttcattaaggatgacacattattagtgcgctgtgaggtctcc
acccgctttgacatgggtagccttcggagggagggttttcagccacgaagtactgatgca
ggggtatag

DBGET integrated database retrieval system